Activin C/Inhibin beta C Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98297

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Activin C Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is INHBC - N-terminal region. Peptide sequence QECEIISFAETGLSTINQTRLDFHFSSDRTAGDREVQQASLMFFVQLPSN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Activin C/Inhibin beta C Antibody - BSA Free

Western Blot: Activin C/Inhibin beta C Antibody [NBP1-98297]

Western Blot: Activin C/Inhibin beta C Antibody [NBP1-98297]

Western Blot: Activin C/Inhibin beta C Antibody [NBP1-98297] - Antibody Dilution: 1.0ug/ml Sample Tissue: OVCAR-3 cell lysate.

Applications for Activin C/Inhibin beta C Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Activin C

This gene encodes the beta C chain of inhibin, a member of the TGF-beta superfamily. This subunit forms heterodimers with beta A and beta B subunits. Inhibins and activins, also members of the TGF-beta superfamily, are hormones with opposing actions and are involved in hypothalamic, pituitary, and gonadal hormone secretion, as well as growth and differentiation of various cell types.

Alternate Names

INHBC

Gene Symbol

INHBC

UniProt

NP_005529 (Human)

Additional Activin C Products

Product Documents for Activin C/Inhibin beta C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Activin C/Inhibin beta C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Activin C/Inhibin beta C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Activin C/Inhibin beta C Antibody - BSA Free and earn rewards!

Have you used Activin C/Inhibin beta C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies