Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4)
Novus Biologicals | Catalog # NBP3-15732
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 1J7G4 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 410-509 of human Activin RIA/ALK-2/Activin Receptor Type 1 (Q04771). VLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4)
Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) [NBP3-15732]
Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) [NBP3-15732] - Western blot analysis of extracts of Mouse brain, using Activin RIA/ALK-2/Activin Receptor Type 1 antibody (NBP3-15732) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) [NBP3-15732]
Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) [NBP3-15732] - Western blot analysis of extracts of various cell lines, using Activin RIA/ALK-2/Activin Receptor Type 1 antibody (NBP3-15732) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) [NBP3-15732] -
Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) [NBP3-15732] - Western blot analysis of extracts of various cell lines, using Activin RIA/ALK-2/Activin Receptor Type 1 antibody at1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Applications for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4)
Application
Recommended Usage
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Activin RIA/ALK-2
Long Name
Activin Receptor IA
Alternate Names
ActivinRIA, ACVR1, ALK-2, ALK2
Gene Symbol
ACVR1
Additional Activin RIA/ALK-2 Products
Product Documents for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4)
There are currently no reviews for this product. Be the first to review Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) and earn rewards!
Have you used Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...