ADAM2 Antibody [Biotin]

Name: ADAM2 Antibody [Biotin]
Brand: Novus Biologicals
SKU: NBP3-61947
Price: 749 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-61947

Submit a review

Product Documents

Fc Region Site-Specific Biotinylated Antibody

View Available Formulations

100% Guarantee

Product Specifications
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG

View all ADAM2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: CENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGHPCGLNQWICIDGVCMSGDK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Additional information may be available upon request. The antibody concentration is provided on the individual product label. For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for ADAM2 Antibody [Biotin]

Application

Recommended Usage

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Application Notes

Recommended applications and dilutions are based on validated applications from the unconjugated base product NBP1-70338.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

0.1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: ADAM2

ADAM2, or Disintegrin and metalloproteinase domain-containing protein 2, contains a 82 kDa and a 80 kDa isoform, and is involved in the adhesion of the sperm-egg membrane during fertilization. Current research is being conducted to determine the relationship between ADAM2 and a variety of disorders and diseases, including infertility, epidiymitis, Alzheimer's disease, and reflex sympathetic dystrophy. ADAM2 has been linked to the integrin-mediated signaling pathway and processes involving cellular adhesion, through which it interacts with CD9, CLGN, CRYAB, DNM1, and ITGA9.

Long Name

A Disintegrin and Metalloproteinase Domain 2

Alternate Names

CT15, Fertilin beta, PH-30, PH30, PH30-beta

Gene Symbol

ADAM2

Additional ADAM2 Products

Product Documents for ADAM2 Antibody [Biotin]

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ADAM2 Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Metalloproteases and Regulators

Customer Reviews for ADAM2 Antibody [Biotin]

There are currently no reviews for this product. Be the first to review ADAM2 Antibody [Biotin] and earn rewards!

Have you used ADAM2 Antibody [Biotin]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image