ADAM22 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58310

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ADAM22 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSARLWETSI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ADAM22 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ADAM22 Antibody [NBP2-58310]

Immunocytochemistry/ Immunofluorescence: ADAM22 Antibody [NBP2-58310]

Immunocytochemistry/Immunofluorescence: ADAM22 Antibody [NBP2-58310] - Staining of human cell line HEK 293 shows localization to cell junctions.

Applications for ADAM22 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADAM22

ADAM22 was first described as MDC2 (Metalloproteinase-like disintergin like cysteine rich 2) from analysis of human brain libraries, in search of brain-specific proteins. Two splice variants with different carboxyterminal ends have been described. ADAM22 participates in cell adhesion and spreading by associating with 14-3-3 proteins. It is constitutively produced in normal brain tissue, but decreased or absent in high grade gliomas. Different splice variants of ADAM22 are differentially expressed in areas of the brain. A complex of ADAM22 and LGI1 were shown to regulate synaptic transmission. Complexes of ADAM22, stargazing, and a range of other proteins anchor ADAM22 into the cytoskeleton, and keep ADAM22 in association with the postsynaptic space. ADAM22 does not contain the canonical HExxHxxxxxH zinc metalloproteinase motif, and is not thought to be proteolytically active. ADAM22 is a member of the ADAMS that function in tandem with other ADAMs and which may also have specific individual functions.

Long Name

A Disintegrin and Metalloproteinase Domain 22

Alternate Names

MDC2

Gene Symbol

ADAM22

Additional ADAM22 Products

Product Documents for ADAM22 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ADAM22 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Metalloproteases and Regulators

Customer Reviews for ADAM22 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ADAM22 Antibody - BSA Free and earn rewards!

Have you used ADAM22 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies