ADAM29 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83927

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ADAM29 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of ADAM29. Peptide sequence: DYPFVQDDCYYQGYVEGDSESLVSLSSCFGGFHGLLEINNIVYEIMPKKF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ADAM29 Antibody - BSA Free

Western Blot: ADAM29 Antibody [NBP2-83927]

Western Blot: ADAM29 Antibody [NBP2-83927]

Western Blot: ADAM29 Antibody [NBP2-83927] - WB Suggested Anti-Adam29 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Thymus

Applications for ADAM29 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADAM29

ADAM29, or Disintegrin and metalloproteinase domain-containing protein29, contains an alpha 93 kDa isoform, a beta 87 kDa isoform, and a gamma 90 kDa isoform, and is involved in the processes of fertilization and spermatogenesis. Current research is being conducted on the protein's relation to a variety of cancers, including chronic lymphocytic leukemia, lymphocytic leukemia, and melanoma. ADAM29 has been linked to the processes of proteolysis and spermatogenesis, in which it interacts with ABI2.

Alternate Names

ADAM 29, ADAM metallopeptidase domain 29, Cancer/testis antigen 73, CT73a disintegrin and metalloproteinase domain 29, disintegrin and metalloproteinase domain-containing protein 29, EC 3.4.24, EC 3.4.24.58, svph1

Gene Symbol

ADAM29

Additional ADAM29 Products

Product Documents for ADAM29 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ADAM29 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ADAM29 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ADAM29 Antibody - BSA Free and earn rewards!

Have you used ADAM29 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies