ADAMTS4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56239

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ADAMTS4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit ADAMTS4 Antibody - BSA Free (NBP2-56239) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ADAMTS4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ADAMTS4 Antibody [NBP2-56239]

Immunocytochemistry/ Immunofluorescence: ADAMTS4 Antibody [NBP2-56239]

Immunocytochemistry/Immunofluorescence: ADAMTS4 Antibody [NBP2-56239] - Staining of human cell line U-251 MG shows localization to nuclear speckles.

Applications for ADAMTS4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADAMTS4

ADAMTS4, also known as aggrecanase-1, is a Metallopeptidase M12B type protease that is responsible for degradation of the articular cartilage protein aggrecan and the brain extracellular matrix proteoglycan brevican. The ADAMTS4 protein contains a signal sequence, a propeptide domain, a catalytic domain, a disintegrin-like motif, and a C-terminal domain with a thrombospondin (TSP) type 1 motif. ADAMTS4 has been implicated in inflammatory joint diseases, and it also may be a factor in the progression of glioma and Alzheimer's disease. ADAMTS4 expression has been documented in normal human brain, cartilage, heart, lung, placenta, muscle, and synovium. ESTs have been isolated from human tissue libraries, including normal brain, lung, pancreas, and skeletal muscle and cancerous breast.

Long Name

A Disintegrin-like and Metalloproteinase Domain with Thrombospondin Motifs 4

Alternate Names

ADMP-1, Aggrecanase 1

Gene Symbol

ADAMTS4

Additional ADAMTS4 Products

Product Documents for ADAMTS4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ADAMTS4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Metalloproteases and Regulators

Customer Reviews for ADAMTS4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ADAMTS4 Antibody - BSA Free and earn rewards!

Have you used ADAMTS4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies