ADAT3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84394

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ADAT3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ADAT3. Peptide sequence: VLAYAAPVLDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ADAT3 Antibody - BSA Free

Western Blot: ADAT3 Antibody [NBP2-84394]

Western Blot: ADAT3 Antibody [NBP2-84394]

Western Blot: ADAT3 Antibody [NBP2-84394] - Host: Rabbit. Target Name: ADAT3. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: ADAT3 Antibody [NBP2-84394]

Western Blot: ADAT3 Antibody [NBP2-84394]

Western Blot: ADAT3 Antibody [NBP2-84394] - Host: Rabbit. Target: ADAT3. Positive control (+): HepG2 (HG). Negative control (-): Human lung (LU). Antibody concentration: 1ug/ml

Applications for ADAT3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADAT3

ADAT3 may be involved in deamination of adenosine-34 to inosine in many tRNAs as a regulatory subunit (Potential)

Alternate Names

adenosine deaminase, tRNA-specific 3, TAD3 homolog (S. cerevisiae), FWP005, MST121, MSTP121, S863-5, TAD3, tRNA-specific adenosine deaminase 3 homolog, tRNA-specific adenosine deaminase-like protein 3, tRNA-specific adenosine-34 deaminase subunit ADAT3

Gene Symbol

ADAT3

Additional ADAT3 Products

Product Documents for ADAT3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ADAT3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ADAT3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ADAT3 Antibody - BSA Free and earn rewards!

Have you used ADAT3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies