Adenosine A2aR Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-62698

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Adenosine A2aR Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Adenosine A2aR Antibody - BSA Free

Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698]

Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698]

Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Analysis in human bone marrow and skeletal muscle tissues using NBP2-62698 antibody. Corresponding ADORA2A RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698]

Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698]

Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698]

Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698]

Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Staining of human caudate shows strong membranous positivity.
Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698]

Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698]

Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698]

Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698]

Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Staining of human duodenum shows strong cytoplasmic positivity in enteroendocrine cells.
Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698]

Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698]

Immunohistochemistry-Paraffin: Adenosine A2aR Antibody [NBP2-62698] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for Adenosine A2aR Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 -1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Adenosine A2aR

Adenosine A2a Receptor encodes a protein which is one of several receptor subtypes for adenosine. The activity of the encoded protein, a G-protein coupled receptor family member, is mediated by G proteins which activate adenylyl cyclase. The encoded protein is abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine.

Long Name

Adenosine A2A Receptor

Alternate Names

A2aR, Adenosine A2a R, ADORA2A, RDC8

Gene Symbol

ADORA2A

Additional Adenosine A2aR Products

Product Documents for Adenosine A2aR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Adenosine A2aR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Adenosine A2aR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Adenosine A2aR Antibody - BSA Free and earn rewards!

Have you used Adenosine A2aR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies