Adenosine A3 R Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88764

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human Adenosine A3 R. Peptide sequence: DFTELIVTDDKGTLANDFWSGKDLSGNKTRSCKAPKVVRKADRSRTSILI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Adenosine A3 R Antibody - BSA Free

Western Blot: Adenosine A3 R Antibody [NBP2-88764]

Western Blot: Adenosine A3 R Antibody [NBP2-88764]

Western Blot: Adenosine A3 R Antibody [NBP2-88764] - WB Suggested Anti-ADORA3 Antibody. Titration: 1.0 ug/ml. Positive Control: U937 Whole Cell

Applications for Adenosine A3 R Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Adenosine A3 R

A3 Adenosine Receptor is a widely expressed receptor that mediates the multiple functions of adenosine. For example, this receptor is believed to mediate the protective effect of adenosine released during cardiac ischemia. In lungs, the receptor mediates inhibition of eosinophil chemotaxis and may be useful in the treatment of eosinophil-dependent diseases such as asthma and rhinitis. Adenosine A3 Receptor has been reported mostly in brain, lung, liver, heart, kidney, and testis. ESTs have been isolated from heart/melanocyte/uterus, kidney, pituitary, and placenta libraries.

Long Name

Adenosine A3 Receptor

Alternate Names

A3AR, AD026, Adenosine A3R, ADORA3

Gene Symbol

ADORA3

Additional Adenosine A3 R Products

Product Documents for Adenosine A3 R Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Adenosine A3 R Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Adenosine A3 R Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Adenosine A3 R Antibody - BSA Free and earn rewards!

Have you used Adenosine A3 R Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...