Adenosylhomocysteinase/AHCY Antibody (4E9H10)

Novus Biologicals | Catalog # NBP3-16147

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4E9H10 expressed in HEK293
View all Adenosylhomocysteinase/AHCY Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Adenosylhomocysteinase/AHCY (P23526). GHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Adenosylhomocysteinase/AHCY Antibody (4E9H10)

Western Blot: Adenosylhomocysteinase/AHCY Antibody (4E9H10) [NBP3-16147]

Western Blot: Adenosylhomocysteinase/AHCY Antibody (4E9H10) [NBP3-16147]

Western Blot: Adenosylhomocysteinase/AHCY Antibody (4E9H10) [NBP3-16147] - Western blot analysis of extracts of various cell lines, using Adenosylhomocysteinase/AHCY antibody (NBP3-16147) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.
Western Blot: Adenosylhomocysteinase/AHCY Antibody (4E9H10) [NBP3-16147]

Western Blot: Adenosylhomocysteinase/AHCY Antibody (4E9H10) [NBP3-16147]

Western Blot: Adenosylhomocysteinase/AHCY Antibody (4E9H10) [NBP3-16147] - Western blot analysis of extracts of various cell lines, using Adenosylhomocysteinase/AHCY antibody (NBP3-16147) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunoprecipitation: Adenosylhomocysteinase/AHCY Antibody (4E9H10) [NBP3-16147]

Immunoprecipitation: Adenosylhomocysteinase/AHCY Antibody (4E9H10) [NBP3-16147]

Immunoprecipitation: Adenosylhomocysteinase/AHCY Antibody (4E9H10) [NBP3-16147] - Immunoprecipitation analysis of 300ug extracts of HT-29 cells using 3ug Adenosylhomocysteinase/AHCY antibody (NBP3-16147). Western blot was performed from the immunoprecipitate using Adenosylhomocysteinase/AHCY antibody (NBP3-16147) at a dilition of 1:1000.

Applications for Adenosylhomocysteinase/AHCY Antibody (4E9H10)

Application
Recommended Usage

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Adenosylhomocysteinase/AHCY

S-adenosylhomocysteine hydrolase catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia. S-adenosylhomocysteine hydrolase belongs to the adenosylhomocysteinase family.

Alternate Names

AdoHcyase, AHCY, SAHH

Gene Symbol

AHCY

Additional Adenosylhomocysteinase/AHCY Products

Product Documents for Adenosylhomocysteinase/AHCY Antibody (4E9H10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Adenosylhomocysteinase/AHCY Antibody (4E9H10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Adenosylhomocysteinase/AHCY Antibody (4E9H10)

There are currently no reviews for this product. Be the first to review Adenosylhomocysteinase/AHCY Antibody (4E9H10) and earn rewards!

Have you used Adenosylhomocysteinase/AHCY Antibody (4E9H10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies