Adenosylhomocysteinase/AHCY Antibody (4E9H10)
Novus Biologicals | Catalog # NBP3-16147
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunoprecipitation
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 4E9H10 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Adenosylhomocysteinase/AHCY (P23526). GHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLG
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Adenosylhomocysteinase/AHCY Antibody (4E9H10)
Western Blot: Adenosylhomocysteinase/AHCY Antibody (4E9H10) [NBP3-16147]
Western Blot: Adenosylhomocysteinase/AHCY Antibody (4E9H10) [NBP3-16147] - Western blot analysis of extracts of various cell lines, using Adenosylhomocysteinase/AHCY antibody (NBP3-16147) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.Western Blot: Adenosylhomocysteinase/AHCY Antibody (4E9H10) [NBP3-16147]
Western Blot: Adenosylhomocysteinase/AHCY Antibody (4E9H10) [NBP3-16147] - Western blot analysis of extracts of various cell lines, using Adenosylhomocysteinase/AHCY antibody (NBP3-16147) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.Immunoprecipitation: Adenosylhomocysteinase/AHCY Antibody (4E9H10) [NBP3-16147]
Immunoprecipitation: Adenosylhomocysteinase/AHCY Antibody (4E9H10) [NBP3-16147] - Immunoprecipitation analysis of 300ug extracts of HT-29 cells using 3ug Adenosylhomocysteinase/AHCY antibody (NBP3-16147). Western blot was performed from the immunoprecipitate using Adenosylhomocysteinase/AHCY antibody (NBP3-16147) at a dilition of 1:1000.Applications for Adenosylhomocysteinase/AHCY Antibody (4E9H10)
Application
Recommended Usage
Immunoprecipitation
1:500 - 1:1000
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Adenosylhomocysteinase/AHCY
Alternate Names
AdoHcyase, AHCY, SAHH
Gene Symbol
AHCY
Additional Adenosylhomocysteinase/AHCY Products
Product Documents for Adenosylhomocysteinase/AHCY Antibody (4E9H10)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Adenosylhomocysteinase/AHCY Antibody (4E9H10)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Adenosylhomocysteinase/AHCY Antibody (4E9H10)
There are currently no reviews for this product. Be the first to review Adenosylhomocysteinase/AHCY Antibody (4E9H10) and earn rewards!
Have you used Adenosylhomocysteinase/AHCY Antibody (4E9H10)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- Immunoprecipitation Protocol
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...