Adenylosuccinate Synthase Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92661

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Adenylosuccinate Synthase Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ADSS (NP_001117.2). MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRCQGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGLEGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLRMCDLVSDFDGFSERFKVLANQYKSIYPTLEIDIEGELQKLKGYMEKIKPMVRDGVYFLYEALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Adenylosuccinate Synthase Antibody - BSA Free

Western Blot: Adenylosuccinate Synthase AntibodyBSA Free [NBP2-92661]

Western Blot: Adenylosuccinate Synthase AntibodyBSA Free [NBP2-92661]

Western Blot: Adenylosuccinate Synthase Antibody [NBP2-92661] - Analysis of extracts of various cell lines, using Adenylosuccinate Synthase at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.
Adenylosuccinate Synthase Antibody - BSA Free

Immunohistochemistry: Adenylosuccinate Synthase Antibody - BSA Free [NBP2-92661] -

Immunohistochemistry: Adenylosuccinate Synthase Antibody - BSA Free [NBP2-92661] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using Adenylosuccinate Synthase Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Adenylosuccinate Synthase Antibody - BSA Free

Immunohistochemistry: Adenylosuccinate Synthase Antibody - BSA Free [NBP2-92661] -

Immunohistochemistry: Adenylosuccinate Synthase Antibody - BSA Free [NBP2-92661] - Immunohistochemistry analysis of paraffin-embedded Human colon using Adenylosuccinate Synthase Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Adenylosuccinate Synthase Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Adenylosuccinate Synthase Antibody - BSA Free [NBP2-92661] -

Immunocytochemistry/ Immunofluorescence: Adenylosuccinate Synthase Antibody - BSA Free [NBP2-92661] - Immunofluorescence analysis of HeLa cells using Adenylosuccinate Synthase Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Adenylosuccinate Synthase Antibody - BSA Free

Immunohistochemistry: Adenylosuccinate Synthase Antibody - BSA Free [NBP2-92661] -

Immunohistochemistry: Adenylosuccinate Synthase Antibody - BSA Free [NBP2-92661] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using Adenylosuccinate Synthase Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Adenylosuccinate Synthase Antibody - BSA Free

Immunohistochemistry: Adenylosuccinate Synthase Antibody - BSA Free [NBP2-92661] -

Immunohistochemistry: Adenylosuccinate Synthase Antibody - BSA Free [NBP2-92661] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using Adenylosuccinate Synthase Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Adenylosuccinate Synthase Antibody - BSA Free

Western Blot: Adenylosuccinate Synthase Antibody - BSA Free [NBP2-92661] -

Western Blot: Adenylosuccinate Synthase Antibody - BSA Free [NBP2-92661] - Western blot analysis of various lysates using Adenylosuccinate Synthase Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for Adenylosuccinate Synthase Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Adenylosuccinate Synthase

Adenylosuccinate synthetase catalyzes the first committed step in the conversion of IMP to AMP [provided by RefSeq]

Alternate Names

ADEH, adenylosuccinate synthase, adenylosuccinate synthetase (Ade(-)H-complementing), adenylosuccinate synthetase isozyme 2, Adenylosuccinate synthetase, acidic isozyme, Adenylosuccinate synthetase, liver isozyme, AdSS 2, ADSS2, AMPSase 2, EC 6.3.4.4, IMP--aspartate ligase 2, L-type adenylosuccinate synthetase, MGC20404

Gene Symbol

ADSS2

Additional Adenylosuccinate Synthase Products

Product Documents for Adenylosuccinate Synthase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Adenylosuccinate Synthase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Adenylosuccinate Synthase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Adenylosuccinate Synthase Antibody - BSA Free and earn rewards!

Have you used Adenylosuccinate Synthase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies