AICDA Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10976

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all AICDA Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT (NP_065712). Peptide sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for AICDA Antibody - BSA Free

Immunohistochemistry-Paraffin: AICDA Antibody [NBP3-10976]

Immunohistochemistry-Paraffin: AICDA Antibody [NBP3-10976]

Immunohistochemistry-Paraffin: AICDA Antibody [NBP3-10976] - Immunohistochemistry with formalin-fixed paraffin-embedded human tonsil tissue at an antibody concentration of 10 ug/ml.

Applications for AICDA Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AICDA

Activation-induced cytidine deaminase (AID) was initially discovered as a homolog of the apolipoprotein B RNA-editing cytidine deaminase 1 (APOBEC1) that showed cytidine deaminase properties in stimulated B cell lines. It is necessary for somatic hypermutation and class switch recombination in B cells, but inappropriate or dysregulated expression AID is often found in tumors and B cell neoplasms. Although it is structurally and functionally similar to the APOBEC proteins, it appears unlikely that AID deaminates dC to dU residues in HIV cDNA as does APOBEC3G.

Long Name

Activation-Induced Cytidine Deaminase

Alternate Names

AID, Arp2, CDA2, HIGM2

Gene Symbol

AICDA

Additional AICDA Products

Product Documents for AICDA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AICDA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AICDA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AICDA Antibody - BSA Free and earn rewards!

Have you used AICDA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies