AKAP9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80308

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human AKAP9. Peptide sequence MEDEERQKKLEAGKAKLAQFRQRKAQSDGQSPSKKQKKKRKTSSSKHDVS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for AKAP9 Antibody - BSA Free

Western Blot: AKAP9 Antibody [NBP1-80308]

Western Blot: AKAP9 Antibody [NBP1-80308]

Western Blot: AKAP9 Antibody [NBP1-80308] - Titration: 1.25ug/ml, Positive Control: Jurkat cell lysate.

Applications for AKAP9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AKAP9

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. Alternate splicing of this gene results in many isoforms that localize to the centrosome and the Golgi apparatus, and interact with numerous signaling proteins from multiple signal transduction pathways. These signaling proteins include type II protein kinase A, serine/threonine kinase protein kinase N, protein phosphatase 1, protein phosphatase 2a, protein kinase C-epsilon and phosphodiesterase 4D3. [provided by RefSeq]

Alternate Names

A kinase (PRKA) anchor protein (yotiao) 9, AKAP 350, AKAP 450, AKAP350A-kinase anchor protein 450 kDa, AKAP450A-kinase anchor protein 350 kDa, AKAP-9, Centrosome- and Golgi-localized PKN-associated protein, CG-NAPAKAP 120-like protein, hgAKAP 350, HYPERION, KIAA0803A-kinase anchor protein 9, MU-RMS-40.16A, PRKA9AKAP9-BRAF fusion protein, Protein hyperion, protein kinase A anchoring protein 9, Protein kinase A-anchoring protein 9, Protein yotiao, YOTIAOkinase N-associated protein

Gene Symbol

AKAP9

Additional AKAP9 Products

Product Documents for AKAP9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AKAP9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AKAP9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AKAP9 Antibody - BSA Free and earn rewards!

Have you used AKAP9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...