AKR7A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98519

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for this antibody is AKR7A2 - N-terminal region. Peptide sequence SETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for AKR7A2 Antibody - BSA Free

Western Blot: AKR7A2 Antibody [NBP1-98519]

Western Blot: AKR7A2 Antibody [NBP1-98519]

Western Blot: AKR7A2 Antibody [NBP1-98519] - Antibody Dilution: 1.0ug/ml Sample Tissue: Human Liver.

Applications for AKR7A2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AKR7A2

The protein encoded by this gene belongs to the aldo/keto reductase (AKR) superfamily and AKR7 family, which are involved in the detoxification of aldehydes and ketones. The AKR7 family consists of 3 genes that are present in a cluster on the p arm of chromosome 1. This protein, thought to be localized in the golgi, catalyzes the NADPH-dependent reduction of succinic semialdehyde to the endogenous neuromodulator, gamma-hydroxybutyrate. It may also function as a detoxication enzyme in the reduction of aflatoxin B1 and 2-carboxybenzaldehyde.

Alternate Names

AFAR1, AFARAFB1-AR1, AFB1 aldehyde reductase 1, AFB1-AR 1, aflatoxin B1 aldehyde reductase member 2, aflatoxin beta1 aldehyde reductase, AKR7, aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase), Aldoketoreductase 7, EC 1.1.1.n11, SSA reductase, Succinic semialdehyde reductase

Gene Symbol

AKR7A2

Additional AKR7A2 Products

Product Documents for AKR7A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AKR7A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AKR7A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AKR7A2 Antibody - BSA Free and earn rewards!

Have you used AKR7A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...