ALG12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86977

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ALG12 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALG12. Peptide sequence: EESFNLQATHDLLYHWQDLEQYDHLEFPGVVPRTFLGPVVIAVFSSPAVY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ALG12 Antibody - BSA Free

Western Blot: ALG12 Antibody [NBP2-86977]

Western Blot: ALG12 Antibody [NBP2-86977]

Western Blot: ALG12 Antibody [NBP2-86977] - Host: Rabbit. Target Name: ALG12. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for ALG12 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ALG12

ALG12 encodes a member of the glycosyltransferase 22 family. The encoded protein catalyzes the addition of the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation. Mutations in this gene have been associated with congenital disorder of glycosylation type Ig (CDG-Ig)characterized by abnormal N-glycosylation.

Alternate Names

alpha-1,6-mannosyltransferase), asparagine-linked glycosylation 12 homolog (S. cerevisiae, asparagine-linked glycosylation 12 homolog (yeast, asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 12 homolog, CDG1G, dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase, dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-alpha-6-mannosyltransferase, EC 2.4.1.-, ECM39, hALG12, Mannosyltransferase ALG12 homolog, Membrane protein SB87, MGC111358, MGC3136, PP14673

Gene Symbol

ALG12

Additional ALG12 Products

Product Documents for ALG12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ALG12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ALG12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ALG12 Antibody - BSA Free and earn rewards!

Have you used ALG12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies