ALG3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91658

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ALG3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIR

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ALG3 Antibody - BSA Free

Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658]

Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658]

Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658]

Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658]

Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658] - Staining of human kidney shows distinct cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658]

Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658]

Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658] - Staining of human placenta shows moderate cytoplasmic postivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658]

Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658]

Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658] - Staining of human gastrointestinal shows strong cytoplasmic postivity in glandular cells.
Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658]

Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658]

Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
ALG3 Antibody - BSA Free Immunohistochemistry: ALG3 Antibody - BSA Free [NBP1-91658]

Immunohistochemistry: ALG3 Antibody - BSA Free [NBP1-91658]

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
ALG3 Antibody - BSA Free Immunohistochemistry: ALG3 Antibody - BSA Free [NBP1-91658]

Immunohistochemistry: ALG3 Antibody - BSA Free [NBP1-91658]

Staining of human gastrointestinal shows strong cytoplasmic positivity in glandular cells.

Applications for ALG3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ALG3

The ALG3 gene encodes a member of the ALG3 family. The encoded protein catalyses the addition of the first dol-P-Man derived mannose in an alpha 1,3 linkage to Man5GlcNAc2-PP-Dol. Defects in this gene have been associated with congenital disorder of glycosyla

Alternate Names

alpha-1,3-mannosyltransferase), asparagine-linked glycosylation 3 homolog (S. cerevisiae, asparagine-linked glycosylation 3 homolog (yeast, asparagine-linked glycosylation 3, alpha-1,3- mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 3 homolog, carbohydrate deficient glycoprotein syndrome type IV, CDGS4D16Ertd36e, Dolichyl-phosphate-mannose--glycolipid alpha-mannosyltransferase, dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase, dol-P-Man dependent alpha(1-3)-mannosyltransferase, Dol-P-Man-dependent alpha(1-3)-mannosyltransferase, EC 2.4.1.130, NOT, Not56, NOT56LCDG1D, Not56-like protein

Entrez Gene IDs

10195 (Human)

Gene Symbol

ALG3

UniProt

Q92685 (Human)

Additional ALG3 Products

Product Documents for ALG3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ALG3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ALG3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ALG3 Antibody - BSA Free and earn rewards!

Have you used ALG3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies