ALG5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86978

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ALG5 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of ALG5. Peptide sequence: ALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVIT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ALG5 Antibody - BSA Free

Western Blot: ALG5 Antibody [NBP2-86978]

Western Blot: ALG5 Antibody [NBP2-86978]

Western Blot: ALG5 Antibody [NBP2-86978] - WB Suggested Anti-ALG5 Antibody. Titration: 1.0 ug/ml. Positive Control: COLO205 Whole CellALG5 is supported by BioGPS gene expression data to be expressed in COLO205

Applications for ALG5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ALG5

ALG5, also known as Dolichyl-phosphate beta-glucosyltransferase, has a 37 kDa and a 34 kDa isoform, and is involved in the process of substrate recognition. Disease research is currently being conducted on ALG5 and its relation to the congenital disorder of glycosylation. The protein has been linked to several protein metabolism, biosynthesis, and modification pathways, where it interacts with ACER3, DDOST, PIGK, RPN1, and ALG12.

Alternate Names

Alg5, S. cerevisiae, homolog of, asparagine-linked glycosylation 5 homolog (S. cerevisiae, dolichyl-phosphatebeta-glucosyltransferase), asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphatebeta-glucosyltransferase), asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferasehomolog (S. cerevisiae), Asparagine-linked glycosylation protein 5 homolog, bA421P11.2, dolichyl phosphate glucosyltransferase, dolichyl-phosphate beta-glucosyltransferase, dolP-glucosyltransferase, EC 2.4.1, EC 2.4.1.117, RP11-421P11.2

Gene Symbol

ALG5

Additional ALG5 Products

Product Documents for ALG5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ALG5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ALG5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ALG5 Antibody - BSA Free and earn rewards!

Have you used ALG5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies