alpha-1B Adrenergic R/ADRA1B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57288

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all alpha-1B Adrenergic R/ADRA1B Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for alpha-1B Adrenergic R/ADRA1B Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: alpha-1B Adrenergic R/ADRA1B Antibody [NBP2-57288]

Immunocytochemistry/ Immunofluorescence: alpha-1B Adrenergic R/ADRA1B Antibody [NBP2-57288]

Immunocytochemistry/Immunofluorescence: alpha-1B Adrenergic R/ADRA1B Antibody [NBP2-57288] - Staining of human cell line U-251 MG shows localization to plasma membrane.

Applications for alpha-1B Adrenergic R/ADRA1B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: alpha-1B Adrenergic R/ADRA1B

The alpha-1b adrenoceptor is an Adrenergic Receptor that causes contraction of smooth muscle cells and thereby controls vascular tone, blood pressure, and accelerates the development of atherosclerosis. Decreased alpha-1b adrenoceptor is associated with benign prostatic hyperplasia (BPH). This adrenergic receptor also acts as a proto-oncogene when transfected into cell lines where constitutive activation of the receptor induces neoplastic transformation. The alpha-1b adrenoceptor has been documented in adrenal, aorta, blood, various brain regions, eye, heart, kidney, liver, prostate, spinal cord, and spleen. ESTs have been isolated from kidney (normal and cancer) and lung carcinoma libraries.

Long Name

Alpha-1B Adrenergic Receptor

Alternate Names

a-1B AdrenergicR, ADRA1B, alpha1B AdrenergicR, ALPHA1BAR

Gene Symbol

ADRA1B

Additional alpha-1B Adrenergic R/ADRA1B Products

Product Documents for alpha-1B Adrenergic R/ADRA1B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for alpha-1B Adrenergic R/ADRA1B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for alpha-1B Adrenergic R/ADRA1B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review alpha-1B Adrenergic R/ADRA1B Antibody - BSA Free and earn rewards!

Have you used alpha-1B Adrenergic R/ADRA1B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies