alpha 1B-Glycoprotein Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57965

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all alpha 1B-Glycoprotein Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to A1BG (alpha-1-B glycoprotein) The peptide sequence was selected from the N terminal of A1BG. Peptide sequence MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for alpha 1B-Glycoprotein Antibody - BSA Free

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965]

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965]

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965] - Reccomended Titration: 1.25 ug/mlPositive Control: HepG2 Whole Cell ACAT2 is supported by BioGPS gene expression data to be expressed in HepG2
Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965]

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965]

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965] - Fetal Liver tissue lysate at a concentration of 0.1ug/ml.
Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965]

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965]

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965] - Sample Type: HepG2 Antibody Dilution: 1.0 ug/ml ACAT2 is supported by BioGPS gene expression data to be expressed in HepG2
Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965]

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965]

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml ACAT2 is supported by BioGPS gene expression data to be expressed in 721_B
Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965]

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965]

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965] - Reccomended Titration: 5 ug/ml Positive Control: human liver, human serum, human plasma

Applications for alpha 1B-Glycoprotein Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: alpha 1B-Glycoprotein

A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.

Alternate Names

A1B, A1BG, ABG, alpha 1BGlycoprotein, GAB

Gene Symbol

A1BG

UniProt

P04217 (Human)

Additional alpha 1B-Glycoprotein Products

Product Documents for alpha 1B-Glycoprotein Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for alpha 1B-Glycoprotein Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers
Eosinophils
Neutrophils

Customer Reviews for alpha 1B-Glycoprotein Antibody - BSA Free

There are currently no reviews for this product. Be the first to review alpha 1B-Glycoprotein Antibody - BSA Free and earn rewards!

Have you used alpha 1B-Glycoprotein Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies