alpha 1B-Glycoprotein Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57969

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to A1BG(alpha-1-B glycoprotein) The peptide sequence was selected from the N terminal of A1BG (NP_570602). Peptide sequence ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for alpha 1B-Glycoprotein Antibody - BSA Free

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57969]

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57969]

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57969] - Antibody Titration: 0.1 ug/ml Positive control: Fetal Liver.
Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57969]

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57969]

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57969] - HepG2 tissue lysate at a concentration of 1ug/ml.
Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57969]

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57969]

Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57969] - Antibody Titration: 5 ug/ml Positive control: human liver, human serum, human plasma.

Applications for alpha 1B-Glycoprotein Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: alpha 1B-Glycoprotein

A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins. The protein encoded by this gene is a plasma glycoprotein of unknown function. The protein shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-7 BX325198.2 1-7 8-1722 AB073611.1 1-1715 1723-1766 AK056201.1 462-505

Alternate Names

A1B, A1BG, ABG, alpha 1BGlycoprotein, GAB

Entrez Gene IDs

1 (Human)

Gene Symbol

A1BG

UniProt

Additional alpha 1B-Glycoprotein Products

Product Documents for alpha 1B-Glycoprotein Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for alpha 1B-Glycoprotein Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for alpha 1B-Glycoprotein Antibody - BSA Free

There are currently no reviews for this product. Be the first to review alpha 1B-Glycoprotein Antibody - BSA Free and earn rewards!

Have you used alpha 1B-Glycoprotein Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...