ALPPL2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57946

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ALPPL2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ALPPL2(alkaline phosphatase, placental-like 2) The peptide sequence was selected from the N terminal of ALPPL2 (NP_112603). Peptide sequence MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ALPPL2 Antibody - BSA Free

Western Blot: ALPPL2 Antibody [NBP1-57946]

Western Blot: ALPPL2 Antibody [NBP1-57946]

Western Blot: ALPPL2 Antibody [NBP1-57946] - HepG2 cell lysate, concentration 2.5 ug/ml.

Applications for ALPPL2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ALPPL2

There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The exact physiological function of the alkaline phosphatases is not known. ALPPL2 is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. The exact physiological function of the alkaline phosphatases is not known. The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.

Alternate Names

Alkaline phosphatase Nagao isozyme, alkaline phosphatase, placental-like, alkaline phosphatase, placental-like 2, ALP-1, ALPG, ALPPL, EC 3.1.3.1, GCAP, Germ cell alkaline phosphatase, Nagao isozyme, Placental alkaline phosphatase-like, placental-like alkaline phosphatase, PLAP-like, testicular and thymus alkaline phosphatase

Entrez Gene IDs

251 (Human)

Gene Symbol

ALPG

Additional ALPPL2 Products

Product Documents for ALPPL2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ALPPL2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ALPPL2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ALPPL2 Antibody - BSA Free and earn rewards!

Have you used ALPPL2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies