Als2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14284

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (91%), Rat (91%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: FQPGLYYSGRQDPTEGDNLPENHSGSKTPVLLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Als2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Als2 Antibody [NBP2-14284]

Immunocytochemistry/ Immunofluorescence: Als2 Antibody [NBP2-14284]

Als2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14284-img0006.jpg
Immunohistochemistry-Paraffin: Als2 Antibody [NBP2-14284]

Immunohistochemistry-Paraffin: Als2 Antibody [NBP2-14284]

Immunohistochemistry-Paraffin: Als2 Antibody [NBP2-14284] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunocytochemistry/ Immunofluorescence: Als2 Antibody [NBP2-14284]

Immunocytochemistry/ Immunofluorescence: Als2 Antibody [NBP2-14284]

Immunocytochemistry/Immunofluorescence: Als2 Antibody [NBP2-14284] - Staining of human cell line U-2 OS shows localization to intermediate filaments. Antibody staining is shown in green.
Als2 Antibody

Immunocytochemistry/ Immunofluorescence: Als2 Antibody [NBP2-14284] -

Immunocytochemistry/ Immunofluorescence: Als2 Antibody [NBP2-14284] - Over-expression of Alsin or Rab5 blocks caspase-3/7 activation.(A) HeLa cells transiently expressing empty vector, Alsin, or Rab5 were incubated in the presence of 500 μM H2O2 & 5 μM CellEvent caspase-3/7 green detection reagent at 37°C for 2 hr. Nucleus was stained with DAPI (blue). Images were acquired by confocal microscopy. Caspase-activated cells displayed green signals, while non-activated cells (PBS control) showed no signal. Percent of cells with positive signals were quantified in (B), n = 50. Error bars represent SEMs. Scale bars, 10 μm.10.7554/eLife.32282.045Figure 10—figure supplement 2—source data 1.Numerical data corresponding to the bar graphs presented in Figure 10—figure supplement 2B.Numerical data corresponding to the bar graphs presented in Figure 10—figure supplement 2B. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/29469808), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Als2 Antibody

Immunocytochemistry/ Immunofluorescence: Als2 Antibody [NBP2-14284] -

Immunocytochemistry/ Immunofluorescence: Als2 Antibody [NBP2-14284] - Validation of the CRISPR/Cas9 Alsin-/- cells in iPSC, NPC & iPSC-sMN.(A) Electrophoresis result of the PCR reaction using primers flanking exon three & within exon 3. Homozygous deletion was confirmed by the absence of a 2.8 kb. (B) Protein lysates from WT KOLF & Alsin-/- iPSC were loaded onto SDS-PAGE & immunoblotted with Alsin antibody. A band detected at ~184 kDa, but absent in Alsin-/-, corresponds to full-length Alsin. (C) WT KOLF, Alsin-/- iPSC, & neuroprogenitor cells (NPC) were immunostained with pluripotency markers Oct4 & Lin28, & neuroprogenitor markers Sox2 & Pax6, respectively. (D–E) WT KOLF & Alsin-/- iPSC-sMN were immunostained with motor neuron markers such as ChAT, HB9, & ISL1, nuclear dye DAPI, & cytoskeletal marker MAP2. (F) WT KOLF & Alsin-/- iPSC-sMN were immunostained with antibodies against Rab5 & Alsin, along with DAPI (nuclear) & phalloidin (actin) stains. Scale bars, 10 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/29469808), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Als2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Als2

Defects in ALS2, or Alsin, are the cause of amyotrophic lateral sclerosis 2 (ALS2), juvenile primary lateral sclerosis (JPLS), and infantile-onset ascending spastic paralysis (IAHSP). ALS2 is a neurodegenerative disorder which is closely related to but clinically distinct from juvenile primary lateral sclerosis. It is a progressive paralytic disorder which results from dysfunction of the motor systems comprising the upper motor neurons of the motor cortex and lower motor neurons of the brain stem and spinal cord. JPLS is a neurodegenerative disorder which is closely related to but clinically distinct from amyotrophic lateral sclerosis. It is a progressive paralytic disorder which results from dysfunction of the upper motor neurons of the motor cortex while the lower neurons are unaffected. IAHSP is characterized by progressive spasticity and weakness of limbs.

Alternate Names

ALS2CR6, alsin, ALSJ, amyotrophic lateral sclerosis 2 (juvenile), amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 6, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 6 protein, Amyotrophic lateral sclerosis 2 protein, FLJ31851, IAHSP, KIAA1563, MGC87187, PLSJ

Gene Symbol

ALS2

Additional Als2 Products

Product Documents for Als2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Als2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Als2 Antibody - BSA Free

Customer Reviews for Als2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Als2 Antibody - BSA Free and earn rewards!

Have you used Als2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...