AMICA/JAML Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-14286
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: KKTCGNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEEEEPSEKSEATYMTMHPVWPSLRSDRNNSL
Reactivity Notes
Reported reactivity in Mouse kidney tissue from a verified customer review.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit AMICA/JAML Antibody - BSA Free (NBP2-14286) is a polyclonal antibody validated for use in IHC and WB. Anti-AMICA/JAML Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for AMICA/JAML Antibody - BSA Free
Western Blot: AMICA/JAML Antibody [NBP2-14286]
Western Blot: AMICA/JAML Antibody [NBP2-14286] - Analysis in human lung tissue.Immunohistochemistry-Paraffin: AMICA/JAML Antibody [NBP2-14286]
Immunohistochemistry-Paraffin: AMICA/JAML Antibody [NBP2-14286] - Immunohistochemical analysis of paraffin embedded mouse kidney tissue using control rabbit IgG (left) and anti-AMICA/JAML antibody (right). Image from verified customer review.Applications for AMICA/JAML Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry-Paraffin
Validated for from a verified customer review
Western Blot
0.04-0.4 ug/ml
Reviewed Applications
Read 1 review rated 5 using NBP2-14286 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: AMICA/JAML
Long Name
Adhesion Molecule, Interacts With CXADR Antigen 1
Alternate Names
AMICA1, CREA7-1, JAML
Entrez Gene IDs
120425 (Human)
Gene Symbol
JAML
Additional AMICA/JAML Products
Product Documents for AMICA/JAML Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for AMICA/JAML Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for AMICA/JAML Antibody - BSA Free
Customer Reviews for AMICA/JAML Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used AMICA/JAML Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Immunohistochemistry-ParaffinSample Tested: kidneySpecies: MouseVerified Customer | Posted 12/15/2016Antibody Storage Conditions:Store at 4C short term. Aliquot and store at -20℃ long term. Avoid freeze-thaw cycles. Test Sample Information: Species & Treatments:mouse Tissue: kidney Fixative Composition: 4% Paraformaldehyde solution Fixation Time & Temperature: 24h,4℃ Tissue Processing: paraffin embedding Antigen Retrieval Details (for IHC-P): Method & Buffer Used: Citric Acid Antigen Retrieval Buffer Time & Temperature: >95℃ 20min Blocking Procedure: Blocking Solution: 5% Goat serum,0.1%BSA Time & Temperature: 1h,room temperature Endogenous Peroxidase Blocking (For IHC-P only) H2O2 cocktail composition: 3% H2O2 Blocking Time: 10min Primary Antibody Dilution: 1:100 Diluent Buffer: 0.1%BSA(PBS) Time & Temperature: overnight,4℃ Washing Conditions: Wash Buffer Composition: PBS Method (Immersion, Rinsing etc.): Immersion Times/Washing: 5min Repetitions: 3 Secondary Antibody Manufacturer and Catalog #: Zhongshan golden bridge ZB-2301 Secondary description:goat anti-rabbit Dilution: 1:100 Diluent Buffer: PBS Incubation Time & Temperature: 1h,room temperature Post-Secondary Washing: 5min X 3 times Detection Method: Detection: Zhongshan golden bridge SP-9000 Procedure: according to the instruction book DAB-Incubation Time (if applicable):3min Controls: Negative Control: Control rabbit IgG
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...