AMPD3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58694

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all AMPD3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PYCLDDAPPNLDYLVHMQGGILFVYDNKKMLEHQEPHSLPYPDLETYTVDMSHILALITDGPTKTYCHRRLNFLES

Reactivity Notes

Mouse 89%, Rat 89%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit AMPD3 Antibody - BSA Free (NBP2-58694) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for AMPD3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: AMPD3 Antibody [NBP2-58694]

Immunocytochemistry/ Immunofluorescence: AMPD3 Antibody [NBP2-58694]

Immunocytochemistry/Immunofluorescence: AMPD3 Antibody [NBP2-58694] - Staining of human cell line A-431 shows localization to nuclear membrane.

Applications for AMPD3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AMPD3

AMPD3, or Adenosine monophosphate deaminase 3, contains a 88 kDa, 24 kDa, 76 kDa, 90 kDa, 89 kDa, and 71 kDa isoform, and is involved in energy metabolism, where it catalyzes the reaction in which adenosine monophosphate transforms into inosine monophosphate. Research currently being conducted on AMPD3 includes its relation with a variety of diseases and disorders, including adenosine monophosphate deaminase deficiency, myopathy, Alzheimer's disease, adenocarcinoma, ischemia, erythrocyte amp deaminase deficiency, hepatocellular carcinoma, hypoxia, malaria, nephropathy, and metabolic disorders. This protein is associated with purine salvage and nucleotide metabolism, in which it interacts with ALB.

Alternate Names

adenosine monophosphate deaminase (isoform E), adenosine monophosphate deaminase 3, AMP aminohydrolase, AMP deaminase 3, AMP deaminase isoform E, EC 3.5.4.6, Erythrocyte AMP deaminase, erythrocyte type AMP deaminase, erythrocyte-specific AMP deaminase, myoadenylate deaminase

Gene Symbol

AMPD3

Additional AMPD3 Products

Product Documents for AMPD3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AMPD3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AMPD3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AMPD3 Antibody - BSA Free and earn rewards!

Have you used AMPD3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies