Angiomotin like 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55099

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Angiomotin like 1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to AMOTL1(angiomotin like 1) The peptide sequence was selected from the N terminal of AMOTL1. Peptide sequence LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

106 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Angiomotin like 1 Antibody - BSA Free

Western Blot: Angiomotin like 1 Antibody [NBP1-55099]

Western Blot: Angiomotin like 1 Antibody [NBP1-55099]

Western Blot: Angiomotin like 1 Antibody [NBP1-55099] - 293T cells lysate, concentration 0.2-1 ug/ml.

Applications for Angiomotin like 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Angiomotin like 1

AMOTL1 is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.The protein encoded by this gene is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.

Alternate Names

angiomotin like 1, angiomotin-like protein 1, JEAP, junction-enriched and associated protein

Gene Symbol

AMOTL1

UniProt

Q8IY63 (Human)

Additional Angiomotin like 1 Products

Product Documents for Angiomotin like 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Angiomotin like 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Angiomotin like 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Angiomotin like 1 Antibody - BSA Free and earn rewards!

Have you used Angiomotin like 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies