Angiopoietin-like Protein 6/ANGPTL6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10663

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Angiopoietin-like Protein 6/ANGPTL6 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for Anti-Angiopoietin-like Protein 6/ANGPTL6 antibody is: synthetic peptide directed towards the C-terminal region of Human ANGL6 (NP_114123.2). Peptide sequence PESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGG

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Angiopoietin-like Protein 6/ANGPTL6 Antibody - BSA Free

Western Blot: Angiopoietin-like Protein 6/ANGPTL6 Antibody [NBP3-10663]

Western Blot: Angiopoietin-like Protein 6/ANGPTL6 Antibody [NBP3-10663]

Western Blot: Angiopoietin-like Protein 6/ANGPTL6 Antibody [NBP3-10663] - Western blot analysis of Angiopoietin-like Protein 6/ANGPTL6 in Thymus Tumor. Antibody dilution at 1.0ug/ml

Applications for Angiopoietin-like Protein 6/ANGPTL6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Angiopoietin-like Protein 6/ANGPTL6

ANGPTL6 may play a role in the wound healing process. May promote epidermal proliferation, remodeling andregeneration. May promote the chemotactic activity of endothelial cells and induce neovascularization. May counteracthigh-fat diet-induced obesity and related

Alternate Names

AGF, Angiopoietin like Protein 6, ANGPTL6, ARP5

Gene Symbol

ANGPTL6

Additional Angiopoietin-like Protein 6/ANGPTL6 Products

Product Documents for Angiopoietin-like Protein 6/ANGPTL6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Angiopoietin-like Protein 6/ANGPTL6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Angiopoietin-like Protein 6/ANGPTL6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Angiopoietin-like Protein 6/ANGPTL6 Antibody - BSA Free and earn rewards!

Have you used Angiopoietin-like Protein 6/ANGPTL6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies