Angiopoietin-like protein 8/Betatrophin Antibody - Azide and BSA Free

Novus Biologicals | Catalog # H00055908-B01P

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Mouse IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

C19orf80 (AAI46553.1, 1 a.a. - 251 a.a.) full-length human protein. MGDALPPFPGAQPLTGRAWLGSSPVMYCTRTARLRTEPWRLLKLRLLYLRPSVMPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA

Clonality

Polyclonal

Host

Mouse

Isotype

IgG

Scientific Data Images for Angiopoietin-like protein 8/Betatrophin Antibody - Azide and BSA Free

Western Blot: Angiopoietin-like protein 8/Betatrophin Antibody [H00055908-B01P]

Western Blot: Angiopoietin-like protein 8/Betatrophin Antibody [H00055908-B01P]

Western Blot: Angiopoietin-like protein 8/Betatrophin Antibody [H00055908-B01P] - Analysis of C19orf80 expression in transfected 293T cell line by C19orf80 polyclonal antibody. Lane 1: C19orf80 transfected lysate(27.61 KDa). Lane 2: Non-transfected lysate.

Applications for Angiopoietin-like protein 8/Betatrophin Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:1000
Application Notes
This product has been QC tested against mammalian transfected lysate.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.4)

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Angiopoietin-like Protein 8/Betatrophin

Angiopoietin-like, also known as angiopoietin-related proteins, are structurally related to the angiopoietins. They are secreted proteins with N-terminal coiled-coil domains and C-terminal fibrinogen-like domains. Unlike the angiopoietins, ANGPTLs do not bind Tie-2. Seven ANGPTL proteins have been identified (ANGPTL1 through 7).

Alternate Names

Angiopoietin like Protein 8, ANGPTL8, Betatrophin, C19orf80, Gm6484, Lipasin, PRO1185, PVPA599, RIFL, TD26

Entrez Gene IDs

55908 (Human)

Gene Symbol

ANGPTL8

Additional Angiopoietin-like Protein 8/Betatrophin Products

Product Documents for Angiopoietin-like protein 8/Betatrophin Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Angiopoietin-like protein 8/Betatrophin Antibody - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Angiopoietin-like protein 8/Betatrophin Antibody - Azide and BSA Free

Customer Reviews for Angiopoietin-like protein 8/Betatrophin Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Angiopoietin-like protein 8/Betatrophin Antibody - Azide and BSA Free and earn rewards!

Have you used Angiopoietin-like protein 8/Betatrophin Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Angiopoietin-like protein 8/Betatrophin Antibody - Azide and BSA Free

Showing  1 - 2 of 2 FAQs Showing All
  • Q: I am interested in your product, TD26 Antibody (H00055908-B01P). I will be happy, if you can provide me some information. Here are my questions. A. I see your antibody tested in human sample. How about cross reactivity with mouse tissue, such as plasma or liver homogenate? Could it be possible to have details about conditions for the assay? B. Any published data with regard to this antibody? Could you send me a links, if you dont mind?

    A:

    H00055908-B01P has not been tested on mouse samples and the immunogen shares only 74% similarity with mouse. There is only a slight chance that it will cross-react. View our Images, Reviews and Publications tab for a list of known publications for this antibody.

  • Q: We would like to buy your product (H00055908-B01P) for conducting western blot of mice tissues. I know H00055908-B01P is made for detecting human TD26. But is it possible to detect mouse TD26 by using your antibody? Do you have any data or did you confirm for this?

    A:

    Unfortunately, the immunogen used to generate H00055908-B01P shares only 73% homology with mouse TD26, so it is not predicted to cross-react. If you would be interested in testing this novel species, please take a look at our Innovator's Reward program.

  • Q: I am interested in your product, TD26 Antibody (H00055908-B01P). I will be happy, if you can provide me some information. Here are my questions. A. I see your antibody tested in human sample. How about cross reactivity with mouse tissue, such as plasma or liver homogenate? Could it be possible to have details about conditions for the assay? B. Any published data with regard to this antibody? Could you send me a links, if you dont mind?

    A:

    H00055908-B01P has not been tested on mouse samples and the immunogen shares only 74% similarity with mouse. There is only a slight chance that it will cross-react. View our Images, Reviews and Publications tab for a list of known publications for this antibody.

  • Q: We would like to buy your product (H00055908-B01P) for conducting western blot of mice tissues. I know H00055908-B01P is made for detecting human TD26. But is it possible to detect mouse TD26 by using your antibody? Do you have any data or did you confirm for this?

    A:

    Unfortunately, the immunogen used to generate H00055908-B01P shares only 73% homology with mouse TD26, so it is not predicted to cross-react. If you would be interested in testing this novel species, please take a look at our Innovator's Reward program.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Antibodies
Loading...