ANKRD11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52984

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ANKRD11 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ANKRD11 (ankyrin repeat domain 11) The peptide sequence was selected from the N terminal of ANKRD11 (NP_037407). Peptide sequence: KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

298 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ANKRD11 Antibody - BSA Free

Western Blot: ANKRD11 Antibody [NBP1-52984]

Western Blot: ANKRD11 Antibody [NBP1-52984]

Western Blot: ANKRD11 Antibody [NBP1-52984] - Titration: 1.25ug/ml Positive Control: Human Placenta.
Immunohistochemistry-Paraffin: ANKRD11 Antibody [NBP1-52984]

Immunohistochemistry-Paraffin: ANKRD11 Antibody [NBP1-52984]

Immunohistochemistry-Paraffin: ANKRD11 Antibody [NBP1-52984] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Applications for ANKRD11 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

4-8 ug/ml

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ANKRD11

ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.

Alternate Names

ANCO-1, ANCO1ankyrin repeat domain-containing protein 11, ankyrin repeat domain 11, Ankyrin repeat-containing cofactor 1, ankyrin repeat-containing protein 11, LZ16, nasopharyngeal carcinoma susceptibility protein, T13

Entrez Gene IDs

29123 (Human)

Gene Symbol

ANKRD11

UniProt

Q6UB99 (Human)

Additional ANKRD11 Products

Product Documents for ANKRD11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ANKRD11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ANKRD11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ANKRD11 Antibody - BSA Free and earn rewards!

Have you used ANKRD11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies