Annexin A4 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # H00000307-D01P

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

ANXA4 (NP_001144.1, 1 a.a. - 321 a.a.) full-length human protein. MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD

Specificity

ANXA4 - annexin A4,

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Quality control test: Antibody reactive against mammalian transfected lysate.

Scientific Data Images for Annexin A4 Antibody - Azide and BSA Free

Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in mouse intestine.
Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in PC-12.
Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in Raw 264.7.
Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in A-431.
Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in K-562.
Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in human stomach.
Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in mouse brain.
Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in rat brain.
Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P]

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in transfected 293T cell line by ANXA4 polyclonal antibody.Lane 1: ANXA4 transfected lysate(36.10 KDa).Lane 2: Non-transfected lysate.

Applications for Annexin A4 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.4)

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Annexin A4

Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. [provided by RefSeq]

Alternate Names

AIV, Annexin IV, ANX4, ANXA4, Lipocortin IV, PIG28, ZAP36

Entrez Gene IDs

307 (Human)

Gene Symbol

ANXA4

Additional Annexin A4 Products

Product Documents for Annexin A4 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Annexin A4 Antibody - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Annexin A4 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Annexin A4 Antibody - Azide and BSA Free and earn rewards!

Have you used Annexin A4 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...