Annexin V Antibody (9A5M8)

Novus Biologicals | Catalog # NBP3-16795

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9A5M8 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 221-320 of human Annexin V (NP_001145.1). IEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Annexin V Antibody (9A5M8) (NBP3-16795) is a recombinant monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Annexin V Antibody (9A5M8)

Western Blot: Annexin V Antibody (9A5M8) [NBP3-16795]

Western Blot: Annexin V Antibody (9A5M8) [NBP3-16795]

Western Blot: Annexin V Antibody (9A5M8) [NBP3-16795] - Western blot analysis of extracts of various cell lines, using Annexin A5/Annexin V Rabbit mAb (NBP3-16795) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: Annexin V Antibody (9A5M8) [NBP3-16795]

Western Blot: Annexin V Antibody (9A5M8) [NBP3-16795]

Western Blot: Annexin V Antibody (9A5M8) [NBP3-16795] - Western blot analysis of extracts of various cell lines, using Annexin A5/Annexin V Rabbit mAb (NBP3-16795) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Applications for Annexin V Antibody (9A5M8)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Annexin V

Annexin V is encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa.

Alternate Names

ANX5, ANXA5, ANXV

Gene Symbol

ANXA5

Additional Annexin V Products

Product Documents for Annexin V Antibody (9A5M8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Annexin V Antibody (9A5M8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Annexin V Antibody (9A5M8)

There are currently no reviews for this product. Be the first to review Annexin V Antibody (9A5M8) and earn rewards!

Have you used Annexin V Antibody (9A5M8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Annexin V Antibody (9A5M8)

Showing  1 - 2 of 2 FAQs Showing All
  • Q: I am studying apoptosis in adherent cells. Can I trypsinize the cells when using Annexin V-FITC to stain the cells?

    A: Adherent cells undergoing apoptosis automatically detach from the plate and may not require trypsinization. If there are attached cells, they may be trypsinized without affecting phosphatidylserine (PS).

  • Q: I do not have access to flow cytometer in my building. Can I stain for Annexin V and propidium iodide (PI), fix the cells, then analyze them in a different facility?

    A: Fixing the cells can affect cell permeability, enhancing the uptake of Annexin V and PI intracellularly. As a result, the profile of fixed cells may be different from unfixed cells, and the use of appropriate controls is recommended.

  • Q: I am studying apoptosis in adherent cells. Can I trypsinize the cells when using Annexin V-FITC to stain the cells?

    A: Adherent cells undergoing apoptosis automatically detach from the plate and may not require trypsinization. If there are attached cells, they may be trypsinized without affecting phosphatidylserine (PS).

  • Q: I do not have access to flow cytometer in my building. Can I stain for Annexin V and propidium iodide (PI), fix the cells, then analyze them in a different facility?

    A: Fixing the cells can affect cell permeability, enhancing the uptake of Annexin V and PI intracellularly. As a result, the profile of fixed cells may be different from unfixed cells, and the use of appropriate controls is recommended.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Antibodies
Loading...