ANP32A Antibody (2G11-4A5) - Azide and BSA Free
Novus Biologicals | Catalog # H00008125-M01
![Western Blot: ANP32A Antibody (2G11-4A5) [H00008125-M01]](https://resources.rndsystems.com/images/products/ANP32A-Antibody-2G11-4A5-Western-Blot-H00008125-M01-img0009.jpg "Western Blot: ANP32A Antibody (2G11-4A5) [H00008125-M01]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG1 kappa Clone # 2G11-4A5
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
ANP32A (AAH07200, 1 a.a. ~ 249 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
Specificity
ANP32A - acidic (leucine-rich) nuclear phosphoprotein 32 family, member A
Clonality
Monoclonal
Host
Mouse
Isotype
IgG1 kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for ANP32A Antibody (2G11-4A5) - Azide and BSA Free
Western Blot: ANP32A Antibody (2G11-4A5) [H00008125-M01]
Western Blot: ANP32A Antibody (2G11-4A5) [H00008125-M01] - ANP32A monoclonal antibody (M01), clone 2G11-4A5 Analysis of ANP32A expression in Hela.![Immunocytochemistry/ Immunofluorescence: ANP32A Antibody (2G11-4A5) [H00008125-M01]](https://resources.rndsystems.com/images/products/ANP32A-Antibody-2G11-4A5-Immunocytochemistry-Immunofluorescence-H00008125-M01-img0006.jpg "Immunocytochemistry/ Immunofluorescence: ANP32A Antibody (2G11-4A5) [H00008125-M01]")
Immunocytochemistry/ Immunofluorescence: ANP32A Antibody (2G11-4A5) [H00008125-M01]
Immunocytochemistry/Immunofluorescence: ANP32A Antibody (2G11-4A5) [H00008125-M01] - Analysis of monoclonal antibody to ANP32A on HeLa cell. Antibody concentration 10 ug/ml.![Immunohistochemistry-Paraffin: ANP32A Antibody (2G11-4A5) [H00008125-M01]](https://resources.rndsystems.com/images/products/ANP32A-Antibody-2G11-4A5-Immunohistochemistry-Paraffin-H00008125-M01-img0008.jpg "Immunohistochemistry-Paraffin: ANP32A Antibody (2G11-4A5) [H00008125-M01]")
Immunohistochemistry-Paraffin: ANP32A Antibody (2G11-4A5) [H00008125-M01]
Immunohistochemistry-Paraffin: ANP32A Antibody (2G11-4A5) [H00008125-M01] - Analysis of monoclonal antibody to ANP32A on formalin-fixed paraffin-embedded human tonsil tissue. Antibody concentration 3 ug/ml.![Western Blot: ANP32A Antibody (2G11-4A5) [H00008125-M01]](https://resources.rndsystems.com/images/products/ANP32A-Antibody-2G11-4A5-Western-Blot-H00008125-M01-img0010.jpg "Western Blot: ANP32A Antibody (2G11-4A5) [H00008125-M01]")
Western Blot: ANP32A Antibody (2G11-4A5) [H00008125-M01]
Western Blot: ANP32A Antibody (2G11-4A5) [H00008125-M01] - ANP32A monoclonal antibody (M01), clone 2G11-4A5. Analysis of ANP32A expression in Daudi.Applications for ANP32A Antibody (2G11-4A5) - Azide and BSA Free
Application
Recommended Usage
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Immunocytochemistry/ Immunofluorescence
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry-Paraffin
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: ANP32A
Alternate Names
acidic (leucine-rich) nuclear phosphoprotein 32 family, member A, acidic leucine-rich nuclear phosphoprotein 32 family member A, Acidic nuclear phosphoprotein pp32, cerebellar leucine rich acidic nuclear protein, I1PP2A, inhibitor-1 of protein phosphatase-2A, LANPPutative HLA-DR-associated protein I, Leucine-rich acidic nuclear protein, MAPMC15orf1, mapmodulin, PHAP1MGC150373, PHAPIMGC119787, Potent heat-stable protein phosphatase 2A inhibitor I1PP2A, PP32, putative human HLA class II associated protein I
Entrez Gene IDs
8125 (Human)
Gene Symbol
ANP32A
OMIM
600832 (Human)
UniProt
Additional ANP32A Products
Product Documents for ANP32A Antibody (2G11-4A5) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ANP32A Antibody (2G11-4A5) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for ANP32A Antibody (2G11-4A5) - Azide and BSA Free
Powered by Bioz
Customer Reviews for ANP32A Antibody (2G11-4A5) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review ANP32A Antibody (2G11-4A5) - Azide and BSA Free and earn rewards!
Have you used ANP32A Antibody (2G11-4A5) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...