AP3D1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84438

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all AP3D1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AP3D1. Peptide sequence: RHSSLPTESDEDIAPAQQVDIVTEEMPENALPSDEDDKDPNDPYRALDID The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for AP3D1 Antibody - BSA Free

Western Blot: AP3D1 Antibody [NBP2-84438]

Western Blot: AP3D1 Antibody [NBP2-84438]

Western Blot: AP3D1 Antibody [NBP2-84438] - Host: Rabbit. Target Name: AP3D1. Sample Tissue: Human Hela Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for AP3D1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AP3D1

AP3D1 (also known as Delta-adaptin 3, AP-3 complex delta subunit and Delta-adaptin) is a subunit of the AP3 adaptor-like complex, which is not associated with clathrin. The AP3D1 subunit is implicated in intracellular biogenesis and trafficking of pigment granules and possibly platelet dense granules and neurotransmitter vesicles.

Alternate Names

Adapter-related protein complex 3 subunit delta-1, adaptin, delta, adaptor-related protein complex 3, delta 1 subunit, ADTD, AP-3 complex delta subunit, partial CDS, AP-3 complex subunit delta, AP-3 complex subunit delta-1, delta adaptin, Delta-adaptin, delta-adaptin, partial CDS, hBLVR, subunit of putative vesicle coat adaptor complex AP-3

Gene Symbol

AP3D1

Additional AP3D1 Products

Product Documents for AP3D1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AP3D1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AP3D1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AP3D1 Antibody - BSA Free and earn rewards!

Have you used AP3D1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies