- Products
- products background image
- Services
- Protein Custom Services
- Assay Custom Services
- Antibody Custom Services
- Monoclonal Antibody Panels
- Recombinant Antibody Conversion
- Luminex Custom Services
- Custom Cell Culture Media Services
- Biomarker Testing Services
- Chemistry Services
- Custom Compound Libraries
- Bioactivity Testing Services
- Bulk/Custom Formulation
- Ubiquitin/Proteasome Custom Services
- Custom cDNA Cloning
Expedite Your Research
Expedite Your Research
- Pathways
- Resources
- Research Areas
- Protocols/Troubleshooting Guides/Videos
- Technical Information
- Articles
- Help & FAQs
- Literature
- Request Literature
- Calculators
- Posters
- Blog
- Promotions
- Travel Grants
Posters, Brochures, Whitepapers & Reference Guides
Request Literature
- R&D Systems Quality
- Quality Philosophy
- People
- Place
- Performance
- Product Development
- Customer Satisfaction
- The R&D Systems Quality Advantage
- Documents, Certifications, & FAQs
Experts in Reagent Quality
quality background
- About Us
- Careers
- Bio-Techne Brands
- Investor Relations
Our People are Our Greatest Asset
Join Us
- Contact Us
Product Details
Supplemental Products
Reviews
Biological Activity
Endogenous APJ receptor agonist that is secreted by adipocytes. Binds with high affinity to APJ receptors (IC50 = 5.4 nM) and potently inhibits cAMP production in vitro (EC50 = 0.52 nM). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.
Endogenous APJ receptor agonist that is secreted by adipocytes. Binds with high affinity to APJ receptors (IC50 = 5.4 nM) and potently inhibits cAMP production in vitro (EC50 = 0.52 nM). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.
Technical Data
-
M.Wt:4200.93
-
Formula:C185H304N68O43S
-
Sequence:LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF
-
Solubility:Soluble to 1.60 mg/ml in water
-
Storage:Desiccate at -20°C
-
CAS No:230299-95-3
The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Product Datasheets
COA view current batch
or select another batch:
Tocris Bioscience is the leading supplier of novel and exclusive tools for
life science research with over 30 years' experience in the industry.
Tocris is a Bio-Techne brand.