Home / Apelin Receptor Agonists / Apelin-36 (rat, mouse)

Apelin-36 (rat, mouse)

2427 Datasheet / COA / SDS
Catalog # Availability Size / Price Qty
2427/1
Apelin-36 (rat, mouse)
1 Image
Description: Endogenous apelin agonist
Product Details
Supplemental Products
Reviews
Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

Endogenous APJ receptor agonist that is secreted by adipocytes. Binds with high affinity to APJ receptors (IC50 = 5.4 nM) and potently inhibits cAMP production in vitro (EC50 = 0.52 nM). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.

Technical Data

Formula:
C185H304N68O43S
Sequence:
LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF
Solubility:
Soluble to 1.60 mg/ml in water
Storage:
Store the unopened product at -20 to -70 °C. Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Do not use past expiration date.
CAS No:
230299-95-3

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. Apelin peptides block the entry of human immunodeficiency virus (HIV).
    Zou et al.
    FEBS Lett., 2000;473:15
  2. Molecular properties of apelin: tissue distribution and receptor binding.
    Kawamata et al.
    Biochim.Biophys.Acta, 2001;1538:162
  3. Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor.
    Tatemoto et al.
    Biochem.Biophys.Res.Comms., 1998;251:471

Product Datasheets

COA view current batch
or select another batch:
SDS
Reconstitution Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

VersaClone cDNA Plasmids

Mouse APJ (NP_035914) VersaClone cDNA

RDC0101

Human APJ (NP_005152) VersaClone cDNA

RDC0100

Rat APJ (NP_112639) VersaClone cDNA

RDC2173

Reviews for Apelin-36 (rat, mouse)

There are currently no reviews for this product. Be the first to review Apelin-36 (rat, mouse) and earn rewards!

Have you used Apelin-36 (rat, mouse)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.