APOL3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55075

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all APOL3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TFTFPFGFQGISQRLENVSGYYADARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQILL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit APOL3 Antibody - BSA Free (NBP2-55075) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for APOL3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: APOL3 Antibody [NBP2-55075]

Immunocytochemistry/ Immunofluorescence: APOL3 Antibody [NBP2-55075]

Immunocytochemistry/Immunofluorescence: APOL3 Antibody [NBP2-55075] - Staining of human cell line A-431 shows localization to nuclear bodies & mitochondria. Antibody staining is shown in green.

Applications for APOL3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: APOL3

APOL3 is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. In addition, expression of this gene is upregulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Six transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

APOLIII, apoL-III, apolipoprotein L, 3, apolipoprotein L3, Apolipoprotein L-III, CG12_1, CG121, CG12-1, TNF-inducible protein CG12-1

Gene Symbol

APOL3

Additional APOL3 Products

Product Documents for APOL3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for APOL3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for APOL3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review APOL3 Antibody - BSA Free and earn rewards!

Have you used APOL3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies