Apolipoprotein A-II/ApoA2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57716

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Apolipoprotein A-II/ApoA2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to APOA2 (apolipoprotein A-II) The peptide sequence was selected from the N terminal of APOA2)(50ug). Peptide sequence MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Apolipoprotein A-II/ApoA2 Antibody - BSA Free

Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716]

Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716]

Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716]

Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716]

Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716]

Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716]

Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716]

Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716]

Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716]

Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716]

Western Blot: Apolipoprotein A-II/ApoA2 Antibody [NBP1-57716] - Human HepG2, Antibody Dilution: 1.0 ug/ml APOA2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

Applications for Apolipoprotein A-II/ApoA2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Apolipoprotein A-II/ApoA2

This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.

Alternate Names

Alp-2, APOA2, Apolipoprotein AII, Hdl-1

Gene Symbol

APOA2

UniProt

P02652

Additional Apolipoprotein A-II/ApoA2 Products

Product Documents for Apolipoprotein A-II/ApoA2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Apolipoprotein A-II/ApoA2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers
Obesity

Customer Reviews for Apolipoprotein A-II/ApoA2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Apolipoprotein A-II/ApoA2 Antibody - BSA Free and earn rewards!

Have you used Apolipoprotein A-II/ApoA2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies