Apolipoprotein A-IV/ApoA4 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-86179PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human APOA4.

Source: E. coli

Amino Acid Sequence: LEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86179.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-86179PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Apolipoprotein A-IV/ApoA4

Apoliprotein (apo) A-IV gene contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro.

Alternate Names

Apolipoprotein AIV

Gene Symbol

APOA4

Additional Apolipoprotein A-IV/ApoA4 Products

Product Documents for Apolipoprotein A-IV/ApoA4 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Apolipoprotein A-IV/ApoA4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Apolipoprotein A-IV/ApoA4 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review Apolipoprotein A-IV/ApoA4 Recombinant Protein Antigen and earn rewards!

Have you used Apolipoprotein A-IV/ApoA4 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Apolipoprotein A-IV/ApoA4 Recombinant Protein Antigen

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I would like to buy antibodies APOA4 (apolipoprotein AIV) for the cows (to western blot). I know that You don't have the antibodies for this species. Could You propose the best atibodies which I could test (use) in my experiment?

    A: All eight of our APOA4 antibodies were raised against the human protein, and all of them have currently only been tested against human samples. I ran an alignment for you and found that there is a 77% sequence homology between human and bovine APOA4, so it is possible that the antibodies raised against human APOA4 may recognise the bovine protein. Should you wish to try any of our antibodies with your samples, you may be interested in our Innovator's Reward Program, which allows you to try our primary antibodies in an untested species or application without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...