Aquaporin-5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84445

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Aquaporin 5/AQP5 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Aquaporin-5. Peptide sequence: RFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Aquaporin-5 Antibody - BSA Free

Western Blot: Aquaporin-5 Antibody [NBP2-84445]

Western Blot: Aquaporin-5 Antibody [NBP2-84445]

Western Blot: Aquaporin-5 Antibody [NBP2-84445] - Host: Rabbit. Target Name: AQP5. Sample Type: COLO205 Whole cell lysates. Antibody Dilution: 1.0ug/mlAQP5 is supported by BioGPS gene expression data to be expressed in COLO205

Applications for Aquaporin-5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aquaporin 5/AQP5

Aquaporins (AQPs) are a large family of integral membrane water transport channel proteins that facilitate the transport of water through the cell membrane. This function is conserved in animals, plants and bacteria. At least ten isoforms of aquaporin have been identified in mammals, designated AQP0 through AQP9. Aquaporins are widely distributed and it is not uncommon for more than one type of AQP to be present in the same cell. Although most aquaporins are only permeable to water, AQP3, AQP7 and AQP9 are permeable to urea and glycerol. AQP2 is the only water channel that is activated by vasopressin to enhance water reabsorption in the kidney collecting duct. Aquaporins are involved in renal water absorption, generation of pulmonary secretions, lacrimation, and the secretion and reabsorption of cerebrospinal fluid and aqueous humor. In the lung, the 27-kDa AQP5 is responsible for the majority of water transport across the apical membrane of type I alveolar epithelial cells. The gene encoding human AQP5 maps to chromosome 12q13.

Long Name

Aquaporin 5

Alternate Names

AQP-5, AQP5, PPKB

Gene Symbol

AQP5

Additional Aquaporin 5/AQP5 Products

Product Documents for Aquaporin-5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Aquaporin-5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Ion Channels and Regulators

Customer Reviews for Aquaporin-5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Aquaporin-5 Antibody - BSA Free and earn rewards!

Have you used Aquaporin-5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies