ARF4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79614

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human Arf4The immunogen for this antibody is Arf4. Peptide sequence VGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQD. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This antibody is predicted to react to human ARF1,3,4,5 (100% homology) and 6 (93%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ARF4 Antibody - BSA Free

Western Blot: ARF4 Antibody [NBP1-79614]

Western Blot: ARF4 Antibody [NBP1-79614]

Western Blot: ARF4 Antibody [NBP1-79614] - Human NT-2 cells and Mouse WT brain, concentration 2ug/ml.
Western Blot: ARF4 Antibody [NBP1-79614]

Western Blot: ARF4 Antibody [NBP1-79614]

Western Blot: ARF4 Antibody [NBP1-79614] - Mouse Brain Lysate 1ug/ml Gel Concentration 12%

Applications for ARF4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARF4

The ARF4 gene is a member of the human ARF gene family whose members encode small guanine nucleotide-binding proteins thatstimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and asactivators of phospholipase

Alternate Names

ADP-ribosylation factor 4, ARF2ADP-ribosylation factor 2

Gene Symbol

ARF4

Additional ARF4 Products

Product Documents for ARF4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARF4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARF4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARF4 Antibody - BSA Free and earn rewards!

Have you used ARF4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for ARF4 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I was looking for antibodies against human ARF4 and ARF5 and I need to be able to distinguish between the two proteins. Do you have antibodies specific for each that don't cross react with the other protein?

    A: The sequence similarity between ARF4 and ARF5 shows very high homology between the two proteins. We have not specifically tested for cross-reactivity between the antibodies, but I think it's very likely that they will cross react.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...