ARF6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88768

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ARF6. Peptide sequence: DLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ARF6 Antibody - BSA Free

Western Blot: ARF6 Antibody [NBP2-88768]

Western Blot: ARF6 Antibody [NBP2-88768]

Western Blot: ARF6 Antibody [NBP2-88768] - Host: Rabbit. Target Name: ARF6. Sample Type: MCF7 Whole cell lysates. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: ARF6 Antibody [NBP2-88768]

Immunohistochemistry-Paraffin: ARF6 Antibody [NBP2-88768]

Immunohistochemistry-Paraffin: ARF6 Antibody [NBP2-88768] - Formalin Fixed Paraffin Embedded Tissue: Human Adult liver. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy2/3.
Western Blot: ARF6 Antibody [NBP2-88768]

Western Blot: ARF6 Antibody [NBP2-88768]

Western Blot: ARF6 Antibody [NBP2-88768] - WB Suggested Anti-ARF6 antibody Titration: 1 ug/mL. Sample Type: Human liver

Applications for ARF6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARF6

The ARF6 gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encodesmall guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and playa role in vesicular tr

Long Name

ADP-ribosylation factor 6

Alternate Names

EC 3.6.5.2

Gene Symbol

ARF6

Additional ARF6 Products

Product Documents for ARF6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARF6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARF6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARF6 Antibody - BSA Free and earn rewards!

Have you used ARF6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARF6 Antibody - BSA Free

Showing  1 - 2 of 2 FAQs Showing All
  • Q: I saw another protein purified product ARF6, which is expressed in E.coli. Did you expressed that protein with n-myristoyltransferase co-transformation E.coli?

    A: We do not express the ARF6 protein with n-myristoyltransferase co-transformation E.coli.

  • Q: We would like to buy a myristoylated Arf6 purified protein. If you have myristoylated Arf6 purified protein, please let me know.

    A: Unfortunately, due to our expression system as well as Abnova's, we do not believe that these proteins have post-translational modifications similar to the endogenous protein

  • Q: I saw another protein purified product ARF6, which is expressed in E.coli. Did you expressed that protein with n-myristoyltransferase co-transformation E.coli?

    A: We do not express the ARF6 protein with n-myristoyltransferase co-transformation E.coli.

  • Q: We would like to buy a myristoylated Arf6 purified protein. If you have myristoylated Arf6 purified protein, please let me know.

    A: Unfortunately, due to our expression system as well as Abnova's, we do not believe that these proteins have post-translational modifications similar to the endogenous protein

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Antibodies
Loading...