ARHGAP15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10641

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ARHGAP15 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP15 (NP_060930). Peptide sequence LLSHYDSDIKEQKPEHRKSLMFRLHHSASDTSDKNRVKSRLKKFITRRPS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ARHGAP15 Antibody - BSA Free

Western Blot: ARHGAP15 Antibody [NBP3-10641]

Western Blot: ARHGAP15 Antibody [NBP3-10641]

Western Blot: ARHGAP15 Antibody [NBP3-10641] - Western blot analysis using NBP3-10641 on Transfected 293T as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for ARHGAP15 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARHGAP15

RHO GTPases (see ARHA; MIM 165390) regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15 (Seoh et al., 2003 [PubMed 12650940]).[supplied by OMIM]

Alternate Names

ArhGAP15, BM046, Rho GTPase activating protein 15, rho GTPase-activating protein 15, Rho-type GTPase-activating protein 15

Gene Symbol

ARHGAP15

Additional ARHGAP15 Products

Product Documents for ARHGAP15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARHGAP15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARHGAP15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARHGAP15 Antibody - BSA Free and earn rewards!

Have you used ARHGAP15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies