ARHGAP17 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25283

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ARHGAP17 Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein ARHGAP17 using the following amino acid sequence: VPKPRNRPSVPPPPQPPGVHSAGDSSLTNTAPTASKIVTDSNSRVSEPHRSIFPEMHSDSASKDVPGRILL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ARHGAP17 Antibody - BSA Free

ARHGAP17 Antibody Immunocytochemistry/Immunofluorescence: ARHGAP17 Antibody [NBP3-25283]

Immunocytochemistry/Immunofluorescence: ARHGAP17 Antibody [NBP3-25283]

Staining of human cell line THP-1 shows localization to plasma membrane & cytosol.

Applications for ARHGAP17 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARHGAP17

RICH1 is a GTPase-activating protein (GAP). GAPs stimulate the intrinsic GTP hydrolysis of small G proteins, such as RHOA (MIM 165390), RAC1 (MIM 602048), and CDC42 (MIM 116952).[supplied by OMIM]

Alternate Names

DKFZp564A1363, FLJ10308, FLJ13219, FLJ37567, FLJ43368, MGC87805, MST110, MSTP038, MSTP066, MSTP110, NADRIN, neuron-associated developmentally regulated protein, PP367, PP4534, Rho GTPase activating protein 17, rho GTPase-activating protein 17, RhoGAP interacting with CIP4 homologs 1, RhoGAP interacting with CIP4 homologs protein 1, Rho-type GTPase-activating protein 17, RICH-1, RICH1B, RICH1MST066, WBP15

Gene Symbol

ARHGAP17

Additional ARHGAP17 Products

Product Documents for ARHGAP17 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ARHGAP17 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARHGAP17 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARHGAP17 Antibody - BSA Free and earn rewards!

Have you used ARHGAP17 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies