ARHGAP28 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87026

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ARHGAP28 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of ARHGAP28. Peptide sequence: TKAKDILAKFQYENSHGSSECIKIQNQRLYEIGGNIGEHCLDPDAYILDV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ARHGAP28 Antibody - BSA Free

Western Blot: ARHGAP28 Antibody [NBP2-87026]

Western Blot: ARHGAP28 Antibody [NBP2-87026]

Western Blot: ARHGAP28 Antibody [NBP2-87026] - WB Suggested Anti-ARHGAP28 Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole CellARHGAP28 is supported by BioGPS gene expression data to be expressed in HeLa

Applications for ARHGAP28 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARHGAP28

The ARHGAP28 gene encodes for a Rho GTPase-activating protein 28 that converts them to an inactive GDP-bound state. ARHGAP28 exists in four isoforms: isoform 1 is 729 amino acids long, 82 kDA; isoform 2 is 670 amino acids long, 75 kDA; isoform 3 is 545 amino acids long, nearly 62 kDA; isoform 5 is 570 amino acids long, 64 kDA (note, there is no isoform 4). ARHGAP28 functions in signal transduction and Rho GTPase cycle and has been investigated in various diseases such as benign meningioma.

Alternate Names

DKFZp686A2038, FLJ10312, KIAA1314FLJ27160, Rho GTPase activating protein 28, rho GTPase-activating protein 28, Rho-type GTPase-activating protein 28

Gene Symbol

ARHGAP28

Additional ARHGAP28 Products

Product Documents for ARHGAP28 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARHGAP28 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARHGAP28 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARHGAP28 Antibody - BSA Free and earn rewards!

Have you used ARHGAP28 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies