ARHGEF3 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-57422PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
View all ARHGEF3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARHGEF3.

Source: E. coli

Amino Acid Sequence: LIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57422.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-57422PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ARHGEF3

ARHGEF3, also known as Rho guanine nucleotide exchange factor 3, is a 526 amino acid protein that functions when extracellular interactions activate G coupled protein receptors through conversion of GTP into GDP, by increasing GTPase activity specifically Rho GTPases, which in turn has been shown to have a strong role in bone cells specifically with bone mineral density (BMD). Studies of ARHGEF3 are being done on the following diseases and disorders, hypochromic anemia, osteoporosis, neuronitis, leukemia, arthritis, and spasticity. This protein has interactions with RHOA, RHOB, SHC1, and CDC42 in the G-protein signaling pathways of both RhoA and RhoB, cell death signaling via NRAGE, NRIF and NADE, as well as the interferon pathway.

Alternate Names

DKFZp434F2429, Exchange factor found in platelets and leukemic and neuronal tissues, FLJ98126, MGC118905, Rho guanine nucleotide exchange factor (GEF) 3, rho guanine nucleotide exchange factor 3,59.8 kDA protein, RhoGEF protein, XPLNXPLN

Gene Symbol

ARHGEF3

Additional ARHGEF3 Products

Product Documents for ARHGEF3 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARHGEF3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for ARHGEF3 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review ARHGEF3 Recombinant Protein Antigen and earn rewards!

Have you used ARHGEF3 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes