ARHGEF4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88857

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ARHGEF4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VLYYKGRLDMDGLEVVDLEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQLDQETG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ARHGEF4 Antibody - BSA Free

Immunohistochemistry-Paraffin: ARHGEF4 Antibody [NBP1-88857]

Immunohistochemistry-Paraffin: ARHGEF4 Antibody [NBP1-88857]

Immunohistochemistry-Paraffin: ARHGEF4 Antibody [NBP1-88857] - Staining of human cerebral cortex shows cytoplasmic positivity in neurons.

Applications for ARHGEF4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARHGEF4

Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through Gucleotide exchange protein coupled receptors. Acts as guanine nucleotide exchange factor (GEF) for RhoA and RAC1 GTPases. Binding of APC may activate RAC1 GEF activity. The APC-ARHGEF4 complex seems to be involved in cell migration as well as in E-cadherin-mediated cell-cell adhesion. This protein is similar to rat collybistin protein. Alternative splicing of the gene generates two transcript variants which encode different isoforms.

Alternate Names

APC-stimulated guanine nucleotide exchange factor 1, Asef, Asef1, ASEFAPC-stimulated guanine nucleotide exchange factor, GEF4, KIAA1112, Rho guanine nucleotide exchange factor (GEF) 4, rho guanine nucleotide exchange factor 4, STM6

Gene Symbol

ARHGEF4

Additional ARHGEF4 Products

Product Documents for ARHGEF4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ARHGEF4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ARHGEF4 Antibody - BSA Free

Customer Reviews for ARHGEF4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARHGEF4 Antibody - BSA Free and earn rewards!

Have you used ARHGEF4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies