ARID5A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79440

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human ARID5AThe immunogen for this antibody is ARID5A. Peptide sequence LWKNVYDELGGSPGSTSAATCTRRHYERLVLPYVRHLKGEDDKPLPTSKP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ARID5A Antibody - BSA Free

Western Blot: ARID5A Antibody [NBP1-79440]

Western Blot: ARID5A Antibody [NBP1-79440]

Western Blot: ARID5A Antibody [NBP1-79440] - Sample Tissue: 721_B, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12
Western Blot: ARID5A Antibody [NBP1-79440]

Western Blot: ARID5A Antibody [NBP1-79440]

Western Blot: ARID5A Antibody [NBP1-79440] - 721_B cell. Lane A: Primary Antibody. Lane B: Primary Antibody and Blocking Peptide.
Western Blot: ARID5A Antibody [NBP1-79440]

Western Blot: ARID5A Antibody [NBP1-79440]

Western Blot: ARID5A Antibody [NBP1-79440] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for ARID5A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARID5A

Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles indevelopment, tissue-specific gene expression, and regulation of cell growth (Patsialou et al., 2005 (PubMed15640446)).(supplied by OMIM)

Alternate Names

ARID domain-containing protein 5A, AT rich interactive domain 5A (MRF1-like), AT-rich interactive domain-containing protein 5A, RFVG5814

Gene Symbol

ARID5A

Additional ARID5A Products

Product Documents for ARID5A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARID5A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARID5A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARID5A Antibody - BSA Free and earn rewards!

Have you used ARID5A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...