ARID5B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83622

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation (ChIP), Chemotaxis

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TSKYPSRDMYRESENSSFPSHRHQEKLHVNYLTSLHLQDKKSAAAEAPTDDQPTDLSLPKNPHKPTGKVLGLAHSTTGPQESKGISQFQVLGSQSRDCHPKACRVSPMTMSGPKKYPESLSRSGKPHHVRLENFRKME

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24276541).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ARID5B Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ARID5B Antibody [NBP1-83622]

Immunocytochemistry/ Immunofluorescence: ARID5B Antibody [NBP1-83622]

Immunocytochemistry/Immunofluorescence: ARID5B Antibody [NBP1-83622] - Staining of human cell line BJ shows localization to nucleoplasm & endoplasmic reticulum. Antibody staining is shown in green.
ARID5B Antibody - BSA Free

Western Blot: ARID5B Antibody - BSA Free [NBP1-83622] -

Trimethylation of histone 3 lysine 4 (H3K4me3)‐mediated ARID5B expression at its promoter. (A) Workflow of beta 2GPI/anti‐ beta 2GPI immune complex (IC) treatment and OICR‐9424 exposure in an ex vivo monocyte or THP‐1 cell model that partially mimicked antiphospholipid syndrome (APS). (B) Heatmaps of H3K4me3 Cleavage Under Targets and Tagmentation (CUT&Tag) in an ex vivo THP‐1 cell and monocyte model of APS. (C) Heatmaps of Transposase‐Accessible Chromatin using sequencing (ATAC‐Seq) in an ex vivo THP‐1 cell and monocyte model of APS. (D) Venn diagram showed the intersection of the unique peaks (ARID5B) in the IC group compared to that in the negative control (NC) group between H3K4me3 CUT&Tag and ATAC‐Seq. (E) Integrative Genomics Viewer (IGV) and (F) quantitative PCR (qPCR) showed the relative enrichment levels of H3K4me3 at the promoter of ARID5B. (G) Chromatin accessibility at the ARID5B promoter was displayed using IGV. (H) The protein levels of ARID5B in the ex vivo model of APS were detected using western blotting. (I) Real‐time quantitative PCR (RT‐qPCR) determined the mRNA expression of ARID5B in the ex vivo model of APS. Data information: error bars represent the mean +/- SD of at least three independent experiments. **p <.01; ***p <.001. beta 2GPI, beta2‐glycoprotein I. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38224186), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ARID5B Antibody - BSA Free

Western Blot: ARID5B Antibody - BSA Free [NBP1-83622] -

The activation of ARID5B/LINC01128/BTF3/STAT3 signalling in mice with antiphospholipid syndrome (APS). (A) Workflow of beta2‐glycoprotein I ( beta 2GPI) intraperitoneal injection and OICR‐9429 exposure, beta 2GPI was injected once a week for 3 weeks to generate mice with vascular APS in vivo (number of mice in each group = 5). (B) Anti‐ beta 2GPI levels, (C) activated partial thromboplastin time (APTT) and (D) platelet count (PLT) were detected in the negative control (NC), beta 2GPI and OICR‐9429+ beta 2GPI groups. (E) The blood velocity of the ascending aorta was tested using Doppler ultrasound in the three groups of mice. (F) The thrombus size of the carotid artery was tested by haematoxylin–eosin (HE) staining in the three groups of mice; original magnification, 100×. (G–I) ELISA displaying the serum levels of interleukin (IL)‐18, IL‐1 beta and tissue factor (TF), respectively. (J) Real‐time quantitative PCR (RT‐qPCR) to detect the expression of LINC01128 in the three groups of mice. (K) Western blotting indicated the expression of ARID5B, BTF3 and p‐STAT3/STAT3, the activity of pyroptosis and apoptosis pathways in the three groups of mice. (L) Schematic diagram illustrating the potential mechanism of ARID5B‐mediated LINC01128 in p‐STAT3‐induced pyroptosis and apoptosis activation in APS. Data information: error bars represent the mean +/- SD of at least three independent experiments. M, marker; ns, not significant; **p <.01; ***p <.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38224186), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ARID5B Antibody - BSA Free

Western Blot: ARID5B Antibody - BSA Free [NBP1-83622] -

Trimethylation of histone 3 lysine 4 (H3K4me3)‐mediated ARID5B expression at its promoter. (A) Workflow of beta 2GPI/anti‐ beta 2GPI immune complex (IC) treatment and OICR‐9424 exposure in an ex vivo monocyte or THP‐1 cell model that partially mimicked antiphospholipid syndrome (APS). (B) Heatmaps of H3K4me3 Cleavage Under Targets and Tagmentation (CUT&Tag) in an ex vivo THP‐1 cell and monocyte model of APS. (C) Heatmaps of Transposase‐Accessible Chromatin using sequencing (ATAC‐Seq) in an ex vivo THP‐1 cell and monocyte model of APS. (D) Venn diagram showed the intersection of the unique peaks (ARID5B) in the IC group compared to that in the negative control (NC) group between H3K4me3 CUT&Tag and ATAC‐Seq. (E) Integrative Genomics Viewer (IGV) and (F) quantitative PCR (qPCR) showed the relative enrichment levels of H3K4me3 at the promoter of ARID5B. (G) Chromatin accessibility at the ARID5B promoter was displayed using IGV. (H) The protein levels of ARID5B in the ex vivo model of APS were detected using western blotting. (I) Real‐time quantitative PCR (RT‐qPCR) determined the mRNA expression of ARID5B in the ex vivo model of APS. Data information: error bars represent the mean +/- SD of at least three independent experiments. **p <.01; ***p <.001. beta 2GPI, beta2‐glycoprotein I. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38224186), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ARID5B Antibody - BSA Free

Western Blot: ARID5B Antibody - BSA Free [NBP1-83622] -

ARID5B transcriptionally activated LINC01128 expression. (A) Schematic representation of eight target long non‐coding RNAs (lncRNAs) of ARID5B in anti‐ARID5B Cleavage Under Targets and Tagmentation (CUT&Tag) in THP‐1 cells. (B) The two binding sites of ARID5B at the LINC01128 promoter were predicted using http://bioinfo.life.hust.edu.cn/hTFtarget#!/website. (C) Western blotting and (D) real‐time quantitative PCR (RT‐qPCR) analysis of ARID5B expression after transfection with two shRNAs (shARID5B#1 and shARID5B#2) or overexpression lentivirus in THP‐1 cells and monocytes. (E) RT‐qPCR analysis of LINC01128 expression after transfection with the above shRNAs or overexpression lentivirus. (F) RT‐qPCR analysis of LINC01128 expression after treatment with beta 2GPI/anti‐ beta 2GPI immune complex (IC) in shARID5B‐THP‐1 cells. (G) Integrative Genomics Viewer (IGV) and quantitative PCR (qPCR) representation of anti‐ARID5B CUT&Tag at the LINC01128 promoter in the scrambled negative control (shNC)‐ and shARID5B‐THP‐1 cells. (H) Schematic representation of the mutated sequences of potential ARID5B‐binding sites on the LINC01128 promoter; luciferase activity after transfection with a reporter containing wild‐type (WT‐LINC01128) or mutant LINC01128 (Mut‐LINC01128) promoter constructs in 293T cells. (I) RNA fluorescence in situ hybridisation (FISH) assay showing the subcellular localisation of LINC01128 in THP‐1 cells; U6 was used as a nuclear localisation control; green, LINC01128; red, U6; blue, DAPI. (J) Nuclear fractionation and RT‐qPCR analysis of LINC01128 expression in the nucleus and cytoplasm. Data information: error bars represent the mean +/- SD of at least three independent experiments. ns, not significant; *p <.05; **p <.01; ***p <.001. beta 2GPI, beta2‐glycoprotein I. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38224186), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ARID5B Antibody - BSA Free

Western Blot: ARID5B Antibody - BSA Free [NBP1-83622] -

ARID5B suppresses the expression of CCR2, MCP-1, and TNF-alpha and the migration and adhesion of THP-1 cells. A The protein and mRNA expression of ARID5B in wild-type, ARID5B-overexpressing and ARID5B-knockout THP-1 cells. B Relative mRNA expression levels of CCR2, MCP-1, and TNF-alpha in THP-1 cells. C The migration capacity of THP-1 cells was assessed by Transwell migration assays with an inverted microscope (magnification × 100). D The adhesion of THP-1 cells to HUVECs was assessed using a fluorescence microscope (magnification × 100). All plotted values are the mean +/- SE values of at least three independent experiments. WT, wild type; OE, overexpression; KO, knockout. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35227297), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for ARID5B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARID5B

ARID5B (AT-rich interactive domain-containing protein 5B) is also known as MRF-2 (modulator recognition factor 2) and is member of the AT-rich interaction domain (ARID) family of proteins. Studies of ARID5B in knockout mice indicate a role in the regulation of adipocyte differentiation and leptin expression.

Alternate Names

ARID domain-containing protein 5B, AT rich interactive domain 5B (MRF1-like), DESRTAT-rich interactive domain-containing protein 5B, FLJ21150, Modulator recognition factor 2, modulator recognition factor 2 (MRF2), MRF-2, MRF2MRF1-like protein

Gene Symbol

ARID5B

Additional ARID5B Products

Product Documents for ARID5B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARID5B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ARID5B Antibody - BSA Free

Customer Reviews for ARID5B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARID5B Antibody - BSA Free and earn rewards!

Have you used ARID5B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...