ARL3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69096

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ARL3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ARL3 (ADP-ribosylation factor-like 3) The peptide sequence was selected from the N terminal of ARL3. Peptide sequence QRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ARL3 Antibody - BSA Free

Western Blot: ARL3 Antibody [NBP1-69096]

Western Blot: ARL3 Antibody [NBP1-69096]

Western Blot: ARL3 Antibody [NBP1-69096] - Human 721_B, Antibody Dilution: 1.0 ug/ml ARL3 is supported by BioGPS gene expression data to be expressed in 721_B.
Western Blot: ARL3 Antibody [NBP1-69096]

Western Blot: ARL3 Antibody [NBP1-69096]

Western Blot: ARL3 Antibody [NBP1-69096] - MCF7 Cell Lystae 1ug/ml Gel Concentration 12%

Applications for ARL3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARL3

ARL3 is required for normal cytokinesis. 'ARL3 does not act as an allosteric activator of the cholera toxin catalytic subunit.

Alternate Names

ADP-ribosylation factor-like 3, ARFL3ADP-ribosylation factor-like protein 3, ARF-like 3

Gene Symbol

ARL3

Additional ARL3 Products

Product Documents for ARL3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ARL3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARL3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARL3 Antibody - BSA Free and earn rewards!

Have you used ARL3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies