ARNTL2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69002

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ARNTL2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for anti-Arntl2 antibody: synthetic peptide corresponding to a region of Mouse ARNTL2 (NP_758513). Peptide sequence AILGYLPQELLGTSCYEYFHQDDHSSLTDKHKAVLQSKEKILTDSYKFRV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ARNTL2 Antibody - BSA Free

Western Blot: ARNTL2 Antibody [NBP1-69002]

Western Blot: ARNTL2 Antibody [NBP1-69002]

Western Blot: ARNTL2 Antibody [NBP1-69002] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Heart.

Applications for ARNTL2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
Detects a 64 kDa band in mouse heart samples.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARNTL2

ARNTL2/CLOCK heterodimers activate E-box element (3'-CACGTG-5') transcription. Also, in umbilical vein endothelial cells, Arntl2 activates SERPINE1 through E-box sites. This transactivation is inhibited by PER2 and CRY1.

Alternate Names

Aryl hydrocarbon receptor nuclear translocator-like protein 2, Basic-helix-loop-helix-PAS protein MOP9, BHLHE6, BMAL2, Brain and muscle ARNT-like 2, Class E basic helix-loop-helix protein 6, CLIF, CYCLE-like factor, Member of PAS protein 9, MOP9, PAS domain-containing protein 9, PASD9, Transcription Factor BMAL2

Entrez Gene IDs

56938 (Human); 272322 (Mouse)

Gene Symbol

ARNTL2

UniProt

Q2VPD4 (Mouse)

Additional ARNTL2 Products

Product Documents for ARNTL2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ARNTL2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARNTL2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARNTL2 Antibody - BSA Free and earn rewards!

Have you used ARNTL2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies