ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4) - Azide and BSA Free

Novus Biologicals | Catalog # H00027163-M02

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3F4

Format

Azide and BSA Free
View all ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Primary Antibodies »

Product Specifications

Immunogen

NAAA (NP_055250, 36 a.a. ~ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCD

Reactivity Notes

This product is reactive against Human.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images

Western Blot: ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4) [H00027163-M02]

Western Blot: ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4) [H00027163-M02]

Western Blot: ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4) [H00027163-M02] - Analysis of NAAA expression in transfected 293T cell line by NAAA monoclonal antibody (M02), clone 3F4.Lane 1: NAAA transfected lysate(22 KDa).Lane 2: Non-transfected lysate.
Immunoprecipitation: ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4) [H00027163-M02]

Immunoprecipitation: ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4) [H00027163-M02]

Immunoprecipitation: ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4) [H00027163-M02] - Analysis of NAAA transfected lysate using anti-NAAA monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NAAA MaxPab rabbit polyclonal antibody.

Applications

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunoprecipitation

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is useful for ELISA, Western Blot

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase

This gene encodes an N-acylethanolamine-hydrolyzing enzyme which is highly similar to acid ceramidase. Multiple transcript variants encoding different isoforms have been found for this gene.

Alternate Names

Acid ceramidase-like protein, ASAH-like protein, NAAA, Nacylethanolaminehydrolyzing Acid Amidase

Gene Symbol

NAAA

UniProt

NP_055250 (Human)

Additional ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Products

Product Documents

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews

There are currently no reviews for this product. Be the first to review ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4) - Azide and BSA Free and earn rewards!

Have you used ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies