Asparagine synthetase Antibody (7M10Z7)

Novus Biologicals | Catalog # NBP3-15328

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7M10Z7 expressed in HEK293
View all Asparagine Synthetase/ASNS Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 450-550 of human Asparagine synthetase (P08243). ETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSAR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Asparagine synthetase Antibody (7M10Z7)

Western Blot: Asparagine synthetase Antibody (7M10Z7) [NBP3-15328]

Western Blot: Asparagine synthetase Antibody (7M10Z7) [NBP3-15328]

Western Blot: Asparagine synthetase Antibody (7M10Z7) [NBP3-15328] - Western blot analysis of extracts of various cell lines, using Asparagine synthetase Rabbit mAb (NBP3-15328) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Western Blot: Asparagine synthetase Antibody (7M10Z7) [NBP3-15328]

Western Blot: Asparagine synthetase Antibody (7M10Z7) [NBP3-15328]

Western Blot: Asparagine synthetase Antibody (7M10Z7) [NBP3-15328] - Western blot analysis of extracts of MCF7 cells, using Asparagine synthetase Rabbit mAb (NBP3-15328) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Applications for Asparagine synthetase Antibody (7M10Z7)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Asparagine Synthetase/ASNS

Asparagine synthetase (AS) is a housekeeping enzyme responsible for the production of asparagine from aspartate and glutamine. Most mammalian cells express AS and regulate the level of activity in response to the concentration of asparagine in the medium. Certain tumor cells in contrast, exhibit little or no AS activity and rely on the surrounding medium as a source of exogenous asparagines (1). Therefore tumor cells may be selectively killed by a chemotherapeutic drug using asparaginase. This approach has been exploited in the treatment of certain cancers like childhood acute lymphoblastic leukemia (2).

Long Name

ASNS

Alternate Names

ASNSD, EC 6.3.5.4, Glutamine Dependent Asparagine Synthetase, TS11 Cell Cycle Control Protein

Gene Symbol

ASNS

Additional Asparagine Synthetase/ASNS Products

Product Documents for Asparagine synthetase Antibody (7M10Z7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Asparagine synthetase Antibody (7M10Z7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cell Cycle

Customer Reviews for Asparagine synthetase Antibody (7M10Z7)

There are currently no reviews for this product. Be the first to review Asparagine synthetase Antibody (7M10Z7) and earn rewards!

Have you used Asparagine synthetase Antibody (7M10Z7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies